KEGG   Xanthomonas campestris pv. campestris 8004: XC_2440Help
Entry
XC_2440           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03424  TatD DNase family protein [EC:3.1.21.-]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     XC_2440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TatD_DNase
Motif
Other DBs
NCBI-ProteinID: AAY49490
UniProt: A0A0H2X8B3
Position
complement(2953180..2953908)
Genome map
AA seq 242 aa AA seqDB search
MIDFHCHLDLYADPRQVVSQCVERGLYVLSVTTTPSAWEGTSALAGAAPRIRTSLGLHPQ
IAHERKFELPLFEKLIGRVRYVGEIGLDGSPELKQHWHTQLAVFEQILDLCEGVDGRVMS
LHSRRATKAVLDMLEKHPKSGVPILHWFSGTQRELDRAVEMGCWFSVGPAMLRGEKGRKL
AAAIPQDRILTESDGPFAKMDSRSIWPWEAAQAVVSLAEIWQVNEQAAATRLKANLKQIG
ES
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgattttcactgccacctagacttgtatgccgaccctcgtcaggttgtatcgcaa
tgcgtcgagagaggtttgtatgttttgtcagtaaccacaacgccgtcagcttgggaagga
acttctgccctggctggcgctgcccctcgtatacgtaccagcctaggcttgcacccgcag
attgcgcacgaaaggaagtttgagctgccgttatttgagaagctcataggtcgagtgaga
tatgtcggagagatcggattggacggcagtccggagttgaaacagcactggcatacgcaa
ctggctgtgttcgaacaaattttggatttgtgcgagggggttgatggtagggtcatgtct
ctgcatagcaggagggccacaaaggcggtcttggatatgcttgaaaagcatccaaaatca
ggtgttccgatcctgcattggttttcgggcactcaacgcgagctggatcgcgcagtcgag
atggggtgctggtttagcgttgggcctgcaatgctgcgcggcgagaaaggtagaaaactt
gctgcggctataccgcaggaccgtattcttactgagtcggacggaccttttgctaagatg
gattctcggtcgatttggccctgggaggccgcgcaggctgtggttagccttgctgagatt
tggcaggtcaatgagcaagccgctgcaacacgcctgaaagcaaacttgaagcagattggc
gaatcatag

DBGET integrated database retrieval system