KEGG   Xanthomonas campestris pv. campestris 8004: XC_2448Help
Entry
XC_2448           CDS       T00247                                 

Definition
(GenBank) dihydroorotate dehydrogenase
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00240  Pyrimidine metabolism
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    XC_2448
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     XC_2448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHO_dh FMN_dh NMO
Motif
Other DBs
NCBI-ProteinID: AAY49498
UniProt: Q4UTX5
Position
2961807..2962862
Genome map
AA seq 351 aa AA seqDB search
MYSLARPFLFAFDAERAHALALRAIDTAYRTGTTALVATRPVPLPTPAFGLMFPNPVGLG
AGLDKNGEHIDALLALGFGFVEIGTVTPKPQEGNPKPRMFRLPEYQAVINRMGFNNLGVD
VLVKNVQRARRRGGLLGINIGKNKDTPNEEATSDYRYCMERVYPLADYITVNISSPNTAG
LRELQEEQALRRLIADLRETQEALAAQHGKRVPMLVKVAPDLNDRDIDAAARVLADLAVD
GVIATNTTVTRTLVASHPMAEQAGGLSGAPLLGQSTLVLRRLRARLPESIPLIGVGGITS
GADAVAKMAAGASLVQCYSGLVYRGPRLIGECVDAIRRRRESPSGGAVGPL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtattcgctcgcccgccccttcctgttcgccttcgacgccgagcgcgcccacgcgctg
gccctgcgcgccatcgacaccgcctaccgcaccggcaccacggcgctggtggccacccgg
ccggtgcccctgcccacgcctgccttcgggctgatgttccccaacccggtgggcctgggc
gccgggctggacaagaacggcgagcacatcgatgcgctgctggcattgggcttcgggttt
gtcgagatcggcacggtgacgccgaagccacaggagggcaatcccaagccgcgcatgttc
cggttgcccgaataccaggcggtgatcaaccgcatgggcttcaacaacctgggcgtggat
gtgctggtgaagaacgtgcagcgtgcgcgccggcgcggtggcctgctcggcatcaacatc
ggcaagaacaaggacacgcccaacgaggaagcgaccagcgattaccgctattgcatggag
cgcgtgtatccgctggccgactacatcaccgtcaacatttcctcgcccaataccgccggt
ttacgcgagctgcaggaagaacaggcgctgcgccggctgatcgccgatctgcgcgaaacc
caggaagccctggccgcccaacacggcaagcgcgtgccgatgctggtgaaggtggcaccg
gacctcaacgaccgcgacatcgatgcggccgcacgcgtgttggctgacctggcggtggat
ggcgtgatcgccaccaacaccacggtgacgcgcaccctggtggccagccatccgatggcc
gagcaggccggcggcctgtcgggcgcaccgctgctggggcaatccacgctggtgctgcgt
cgcctgcgtgcacgcctgcccgagtccattccgttgatcggcgtgggcggcatcacgtcc
ggcgccgatgcggtggccaagatggccgccggtgccagcctggtgcagtgctacagcggc
ctggtctatcgcgggccgcgcttgatcggcgagtgcgtggatgcaatccggcgccgccgt
gagtcgcccagtggcggcgcggtggggccgctatga

DBGET integrated database retrieval system