KEGG   Xanthomonas campestris pv. campestris 8004: XC_2450Help
Entry
XC_2450           CDS       T00247                                 

Definition
(GenBank) integral membrane protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA TMEM234 DUF2830
Motif
Other DBs
NCBI-ProteinID: AAY49500
UniProt: A0A0H2X8E9
Position
2963905..2964816
Genome map
AA seq 303 aa AA seqDB search
MVTAQPASARAALWMLVSTFAFGLMAITIRLASKDIATTEIAFFRNAFGLLALLPLIVRP
GKPLPRTRQLPQYLARTLIGLASMLCGFWAIGHLPLSQAISLSYSTPLFVTVLAVIWLHE
QVRLRRWLAVAAGFVGVLVILRPGSSTFTPGLLIALLAAVISAVVAIQIKQLSRSDDSDT
VVFYTYVFWVPMSLIPALFQWTWPHGIDWLWLIATGIFGTAGQLFWTRALKLGEVSALQP
ISFMQLPLVALLGWWLFGEAIARHTVIGAAIIISANVYIAHRETVLARRAATHAPVEGAK
PGE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggtgacggcgcagccagcgtcggcacgcgctgcgctgtggatgctggtcagcacattt
gcgttcggcctgatggccatcaccatccggctggcgtccaaggacatcgccacgaccgag
attgcgttttttcgtaacgcattcggcctgctggcgctgctgccgttgatcgtgcgccct
ggcaaaccgctgccgcgcacgcgccagttaccgcaatacctggcgcgcacgttgatcggc
ctggcctcgatgctgtgcggcttctgggcgatcgggcatctgccgctgtcgcaggccatt
tcgttgtcgtattccacgccgttgtttgtcaccgtgctggcggtgatctggctgcacgag
caggtgcgcctgcgccgctggctggcggtggcggcggggtttgtgggcgtgctggtgatc
ctgcggccaggctcgtccacgttcacgcccgggctgctgattgcactgctggccgcggtg
atcagcgcggtggtcgccatccagatcaagcagctctcgcgtagcgatgattcggacacg
gtggtgttctacacctacgtgttttgggtgccgatgtcgttgatccccgcgttgttccag
tggacctggccacacgggatcgactggctatggctgatcgccaccggcatcttcggtacc
gccgggcaactgttctggacgcgtgcgctcaagctgggcgaagtctctgcgttgcagccg
atcagcttcatgcaattgccactggtggccttgctgggttggtggctgttcggcgaagcg
atcgcgcgccacacggtgatcggtgcggcgatcatcatctctgccaacgtgtacatcgcg
catcgcgaaaccgtgctggcacgccgcgcggcgacgcatgcgccggtggaaggcgccaaa
ccgggtgagtga

DBGET integrated database retrieval system