KEGG   Xanthomonas campestris pv. campestris 8004: XC_2451Help
Entry
XC_2451           CDS       T00247                                 

Definition
(GenBank) putative resistance protein
  KO
K01779  aspartate racemase [EC:5.1.1.13]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00250  Alanine, aspartate and glutamate metabolism
xcb01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XC_2451
  Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    XC_2451
Enzymes [BR:xcb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.13  aspartate racemase
     XC_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AAY49501
UniProt: A0A0H2XA12
Position
2964961..2965665
Genome map
AA seq 234 aa AA seqDB search
MPVPTKTIGLIGGMSWESTLPYYRIINQHLRHACGGLHSAKLLLYSVNFHDIERLQHAGD
WEGAGQAMATAARALQAGGADFIVLCTNTMHCVADAITAATPLPLLHIADATADALVAAG
ILRVGLLGTRFTMEQPFYRERLEARGLDVLVPPAEARAQLHRVIYDELCQGVIKPKSRDY
FRQVMADLGQHGAQAIILGCTEISLLVDSTDAQLPLFDTTALHAEAAALASVSG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgccggtcccaacgaaaaccattggtttgatcggcggaatgagctgggaatccaccctg
ccctattaccgcatcatcaaccagcacttgcgccatgcgtgcggtggcctgcactcggcg
aagctgctgctttacagcgtcaattttcatgacatcgagcggctgcagcacgccggcgat
tgggagggggcgggtcaggcgatggccacggcagcgcgtgcgctgcaggccggaggcgcc
gacttcatcgtgctgtgcaccaacacgatgcactgcgttgctgacgcgatcaccgccgcc
acgcccctgccgctgctgcacatcgccgatgccaccgccgatgcattggtcgccgcgggc
atcctccgtgtcgggctgcttggtacgcgcttcaccatggagcagccgttctatcgcgag
cgactggaagcgcggggcttggatgtgctggtgccgccggccgaggcacgcgcacagctg
catcgggtgatctacgacgagttgtgccagggcgtgatcaaaccgaaatcgcgcgactat
ttccgtcaggtcatggccgacctcggccagcacggtgcgcaagcgatcatcctggggtgc
accgagatttcgctgctggtggacagcaccgatgcgcagctgccgttgttcgacaccacc
gcgttgcacgccgaggcggcggcattggcaagcgtgtccggctga

DBGET integrated database retrieval system