KEGG   Xanthomonas campestris pv. campestris 8004: XC_2453Help
Entry
XC_2453           CDS       T00247                                 

Definition
(GenBank) Prop transport protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr ATG22
Motif
Other DBs
NCBI-ProteinID: AAY49503
UniProt: A0A0H2X9Y5
Position
2966018..2967121
Genome map
AA seq 367 aa AA seqDB search
MDAAVADVRHFCRRLFDPPAGRHCDGPFRRPARAQAHVRAEHRVDGAAHARYRRAADLRA
DRRGGTAVAAHDAAATRRSHWRRGSQRMGVRCRTRARAAQRAGLAAGVLLGSLSAGALNR
AFTPQEIAEYAWRLPFLAGGIFGLLSVYLRRWLHETPVFAELVAMRALARETPLKVVLRD
HPRSLALSLWLTWVVAGAVLVVSLMTPTLLQTAYGYPAPVALQANLLAVLMQAIGSVVAG
ALSDRWGNGRVLLAGSVILGISAWLFYRLAGDPQLLFPLYALLGAALGVLGAIPRVMVEA
FPPVVRLSGVSFAYNLGYAVFGGLTPLLVVLLLKQHPMGPAYYVILLASIGAIVGARLWQ
RERVSIS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggcagttgcagacgttcggcatttttgccgccggctatttgatccgcccgct
gggcggcattgtgatggcccatttcggcgacctgctcgggcgcaagcgcatgttcgcgct
gagcatcgggttgatggcgctgcccacgctcgctatcggcgtgctgccgacctacgcgca
gatcggcgtggcggcaccgctgttgctgctcacgatgcggctgctacaaggcgcagccat
tggcggcgaggttcccagcgcatgggtgttcgttgcagaacacgtgcccgcgcggcgcag
agggctggcctggctgccggcgtgctgcttggttcgctgagcgccggcgcactcaatcgc
gccttcaccccgcaggagatcgccgaatacgcctggcgactgccattcctggccggcggc
atcttcggcctgctgtcggtgtatttgcggcgttggctgcatgaaacgcccgtgttcgcc
gagttggtggccatgcgcgcgctggcacgcgagacgccgctgaaggtggtgctgcgcgat
cacccgcgcagtctcgcgctgtcgttgtggctgacctgggtggtggccggcgcagtgctg
gtggtgtcgctgatgacgcccacgctgctgcagactgcgtatggctatccggcaccggtc
gcgctgcaggccaacctgctggcggtgctcatgcaggccatcggctcggtggtggccggc
gcgctctcggaccgctggggcaacgggcgtgttctgctggccggcagcgtgatcctgggc
atcagcgcatggctgttctatcgcctggcaggcgatccgcaactgctgttcccgctgtat
gccctgctcggtgctgcgctgggcgtgctgggtgcgattccccgcgtgatggtcgaggcg
tttccaccggtggtgcgtctgtccggcgtgtcgtttgcctacaacctgggctatgccgtg
ttcggcggcctgaccccgttgctcgtggtgctgctgctcaagcaacacccgatggggccg
gcgtattacgtgattctgctggcatccatcggagccatcgttggcgctcgcttgtggcaa
cgggagcgtgtcagcatttcttag

DBGET integrated database retrieval system