KEGG   Xanthomonas campestris pv. campestris 8004: XC_2459Help
Entry
XC_2459           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GAF GGDEF GAF_2 GAF_3
Motif
Other DBs
NCBI-ProteinID: AAY49509
UniProt: A0A0H2X9Y9
Position
2972912..2974768
Genome map
AA seq 618 aa AA seqDB search
MHSTPAPVASPLPSALDEAARLAVLHGLCLLDSPPDPVFDTIAAMAARMLGTEIALVSLV
DEHRQWFKARVGLEAPETPRKHAFCAHALRSDDVLVIPDALLDPRFCNNPLVLGAPHIRF
YAGAPLKLRDGHTIGTLCVIGTSPRAGLDAEQRIQLEGLRDLAVLRVENLRSSTYRNGPT
GLPNRARFSEDLDAVLLQRTADSAATAIAVDLCGSDYFRDMVKALGWDYADGYVALAYKR
LISKLPAGTALYRLDTTTFAFMVTTADPLRLSALCSKISKGFVAPLEHQGIPHTAVASIG
AVLLETSYGAADTLRSLTTSVDVAREHCLTWSLYERKHDVVQRNTFRLLAALPAALASSN
QLRLHYQPRVDLHDHRCVAVEALLRWQHPMIGPVMPSDFIPMAEKTALINRITAWVIDQG
IAQAARWQQQGLDFNLALNVSAADLDQPGFVGLLRRGLDRHKLDPRRLEIEFTESAMIRH
PEHLSEQLAAVAALGVHIAIDDFGTGYSNFSYLKQLPASSLKIDQSFVRSLPDSRTDRTL
VPAMIQLGHSLGQRVVAEGIESAQAYAQLRSWGCDEGQGYWIAKPMPAAALEAWLETPWY
QRATDAAPPAPQLEAARL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgcattccacgcccgcccctgtcgcctcccccctcccgtctgcgctcgatgaagcggca
cggctggcggtcctgcacggtctttgcctgctggactcgccgccggacccggtgttcgac
accatcgccgccatggccgcacgcatgctggggaccgagatcgccctggtctccttggtg
gacgaacaccgccaatggttcaaagcccgcgtcggcctggaagcgcctgagaccccgcgc
aaacatgccttctgcgcgcacgcgctgcgctccgatgacgtcctggtgattcccgatgcc
ttgctggacccgcgcttctgcaacaacccgctggtactgggtgcgccgcatatccgcttt
tacgctggcgcaccgctcaagctgcgcgatggccacaccatcggcacgctgtgcgtgatt
ggcaccagcccgcgtgccgggctggatgcggagcaacgcatccaactggaaggcctgcgc
gacctggccgtgctgcgggtcgaaaacctgcgcagcagtacctaccgcaatggccccacc
ggcctgcccaaccgcgcgcgcttcagcgaagacctggacgcggtattgctgcaacgcacg
gccgattccgccgccaccgcgatcgcggtggacctgtgcggcagcgattacttccgcgac
atggtcaaggcgctgggctgggattacgcagacggctatgtggcgctggcctacaagcgt
ttgatcagcaaattgccggccggcaccgccttgtatcggctggatacgaccaccttcgcc
ttcatggtcaccaccgccgacccgctacgcctgagcgcgctgtgcagcaagatttccaag
gggttcgtggcgccgctggagcaccagggcattccgcacactgcggtcgcctcgattggc
gcggtgctgctggaaaccagctacggcgccgccgacacgctgcgctcgctcaccacctcg
gtggatgtcgcccgcgaacattgcctgacctggagcctgtacgagcgtaagcacgacgtg
gtccagcgcaacaccttccgcctgctggccgccctgcccgccgcgctggccagcagcaat
cagctgcgcctgcactaccagccgcgcgtggatctgcacgatcaccgctgcgtggcggtg
gaagcgctactgcgctggcagcacccgatgatcggcccggtgatgccgtcggacttcatt
ccgatggctgaaaaaaccgcgctgatcaaccgcatcaccgcctgggtgatcgaccagggc
atcgcccaggccgcacgctggcaacagcagggcctggacttcaacctggccttgaacgtg
tcggccgccgatctggatcaacccggtttcgtcgggttgctgcgccgcggcctggaccgc
cacaagctcgacccgcgccggctggagatcgaattcaccgaaagcgcgatgatccgccac
cccgagcatctgtccgagcaactggcggccgttgcggcgctgggcgtgcatatcgccatc
gacgacttcggcaccggctacagcaatttcagctacctcaaacaactgccggccagctcg
ctgaagatcgatcaatccttcgtccgctcgctgccggacagccgcaccgaccgcaccctg
gtgccggcgatgatccagctcggccacagcctgggccagcgtgtggtggccgaagggatc
gagtcggcgcaggcctacgcacagctgcgcagctggggctgcgacgaaggccagggctac
tggatcgccaagccgatgcctgccgcagcgctggaagcctggttggagacaccgtggtac
caacgcgccaccgacgctgccccgccagcaccgcaactggaagccgcgcgcctctga

DBGET integrated database retrieval system