KEGG   Xanthomonas campestris pv. campestris 8004: XC_2462Help
Entry
XC_2462           CDS       T00247                                 

Definition
(GenBank) alkaline phosphatase
  KO
K07093  uncharacterized protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF839
Motif
Other DBs
NCBI-ProteinID: AAY49512
UniProt: A0A0H2XA21
Position
2979691..2981676
Genome map
AA seq 661 aa AA seqDB search
MPLPSLPGASMSASPDPTRRRALQLLASVPLLPLGSASAAALQQLGGAALAARPLRPSEN
PARLVSATFHGMPAPTLANPAAMATTTVGSALTVARHDGSTQRYALAYHPFFVTGDQVPD
GHGGTVLAGGYYDIQHRPIIDRSKPGAERPFFSDCPDGSSLLTLPNAKVAGVKGNTVFAV
VQFEYTTRDQAGNDTNRHLPAPIAVLTLDQDPATGKLSLVKYHNVDTAPVHGLWTTCGAS
LSPWNTHLSSEEYEPDATTLAGNTQFRSYSTHLYGDPERANPYHYGHLPEITVHPDGTGS
VRKHYCLGRISHELVQVMPDKRTVLMGDDATNGGLFMFIADREADLSAGTLYVGKWHQTS
GVGPGAATLSWIKLGHATSAEIEALANRLTAADILDVHLSDPGDATFTKIPFNGTYNWIR
IKPGMEKAATYLETHRYAALAGGSLGFTKLEGTTVNARDKIAYMAMSYIVTSMLNGSGDV
KVEGPQSGAVYALNLRGGRRDTKGAPIHSEWVPIDMAAPAALTGHDLAQADGLGNLADPN
RLANPDNLKFSESLRTLFIGEDSSLHVNNFLWAYNVDSGTLTRLLSVPAGAESTGLHAVD
QIHGWTYVMSNFQHPGDWESPLHDTVKATLDPLVRANYKDRFGAAVGYLTGDPVAVQLSK
A
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
ttgccattgccgtcattgcctggagcttcgatgtctgcctcccccgatcccacccgccgc
cgcgccctgcaattgctggcgtcggttcctctgctgccgctgggcagcgccagtgccgca
gcgctgcagcaactcggcggtgccgcattggctgcgcgcccgctgcgtccctcggaaaac
cccgcgcggctggtctcggccactttccacggcatgccggcacccaccctggccaacccg
gcggcgatggccaccaccaccgtcggctcggcactcaccgtggcccggcatgacggcagc
acccagcgctacgctctggcctatcacccgttcttcgtcaccggcgaccaggtgcccgat
ggtcacggcggtaccgtgctggccggcggctattacgacatccagcatcgccccatcatc
gaccgctccaaacccggtgccgagcgcccgttcttttccgattgcccggatgggtcgtcg
ctgctcaccctgcccaatgccaaggtcgcaggcgtcaagggaaacacggtgtttgcggtg
gtgcagttcgaatacaccacccgcgaccaggccggcaacgacaccaaccgccacctgccc
gcaccgatcgccgtgctcacgctcgaccaggacccggcgaccggcaagctgtcgctggtg
aaataccacaacgtcgacaccgcccccgtccacggcttgtggaccacctgcggcgccagc
ctgtcgccgtggaatacgcatctgtccagcgaagagtacgaacccgacgccaccacgctg
gccggcaatacccagttccgcagctacagcacgcatctgtatggcgacccggaacgcgcc
aacccgtaccactacggccacctgccggagatcaccgtgcatccggacggaacggggagc
gtgcgcaagcactattgcctgggccgcatctcgcacgagctggtgcaggtgatgccagac
aagcgcaccgtgctgatgggcgacgacgccaccaacggcgggcttttcatgttcatcgcc
gatcgcgaggccgacctgtcggccggcacgctctacgttggcaagtggcaccagacctcc
ggcgtcggcccgggcgcggccacgttgagctggatcaagctgggccacgccaccagcgcc
gagatcgaagccctcgccaaccgcctcaccgccgccgacattctcgacgtgcacctgagc
gacccgggcgatgccacgttcaccaagattcccttcaacggcacctacaactggatccgc
atcaagccgggcatggagaaggcggccacctatctggaaacccatcgctatgccgcactg
gccggcggcagcctgggcttcaccaagctcgaaggcaccaccgtcaacgcgcgcgacaag
atcgcctacatggcgatgtcctacattgtcaccagcatgctcaacggctcgggcgacgtg
aaggtggaaggcccgcagtccggcgcggtgtatgcgctcaacctgcgtggcgggcgccgc
gacaccaagggcgcaccgatccacagcgaatgggtaccgatcgacatggccgcgcctgcc
gcgctgaccggccacgacctggcgcaggccgacgggctgggcaacctggccgacccgaac
cggctggcgaatccggacaacctcaagttctccgagtcgctgcgcacgctgttcattggc
gaagacagcagcctgcacgtcaacaatttcctgtgggcctacaacgtcgacagcggcacg
ctgacgcgcctgctctcggtgccggccggcgccgaatccaccggcctgcacgcggttgac
cagatccatggctggacctatgtcatgagcaatttccagcaccccggcgactgggaaagc
ccgctgcacgacaccgtcaaggccacgctggatccgttggtgcgcgccaactacaaggat
cgcttcggcgctgcggtgggctacctcaccggtgacccggtggcggtgcagttgagcaag
gcgtaa

DBGET integrated database retrieval system