KEGG   Xanthomonas campestris pv. campestris 8004: XC_2463Help
Entry
XC_2463           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY49513
UniProt: A0A0H2X8C9
Position
complement(2981732..2982208)
Genome map
AA seq 158 aa AA seqDB search
MRRPGRKACGGCAVQWTKATTMPSKPRWVRRQSRVCCSTPVRSTAIAVWFCGLSSVELHL
QRVAARVAAGGHAIAEHKIRERFDASRANLITLLPHLAVLHVYDNSAPTDAAGQVEPLLV
LELDHAGLHYPATAGQLAQVPDWAKPIVMTALEARGVS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggcctggcaggaaggcgtgcggcggctgcgccgtgcaatggacgaaggccacg
actatgccttcgaaaccacgctgggtgcgcagacaatcccgcgtctgttgctcgacgcct
gtgcgcagcaccgcaatcgcggtgtggttttgcggcttgtcgagcgtggagctgcatttg
caacgcgtcgcggcgcgagtggccgcaggtggccatgccattgccgagcacaagatccgc
gagcgctttgatgcatcgcgcgccaacctgatcacgttgttgccgcatctggcggtgctg
catgtgtacgacaacagcgcgccgaccgatgcggccgggcaggtggaaccgctgctggta
ctggagctggatcacgccgggctgcattacccggccaccgccgggcaactggcgcaggtg
ccggactgggcaaaacccattgtgatgacggcactggaggcgcgcggcgtgtcgtga

DBGET integrated database retrieval system