KEGG   Xanthomonas campestris pv. campestris 8004: XC_2464Help
Entry
XC_2464           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY49514
UniProt: A0A0H2X9Z4
Position
complement(2981958..2982239)
Genome map
AA seq 93 aa AA seqDB search
MGQGWALDEANAQAWQEGVRRLRRAMDEGHDYAFETTLGAQTIPRLLLDACAQHRNRGVV
LRLVERGAAFATRRGASGRRWPCHCRAQDPRAL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtggggcagggctgggcgctggacgaggccaatgcgcaggcctggcaggaaggcgtgcgg
cggctgcgccgtgcaatggacgaaggccacgactatgccttcgaaaccacgctgggtgcg
cagacaatcccgcgtctgttgctcgacgcctgtgcgcagcaccgcaatcgcggtgtggtt
ttgcggcttgtcgagcgtggagctgcatttgcaacgcgtcgcggcgcgagtggccgcagg
tggccatgccattgccgagcacaagatccgcgagcgctttga

DBGET integrated database retrieval system