KEGG   Xanthomonas campestris pv. campestris 8004: XC_2465Help
Entry
XC_2465           CDS       T00247                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00030  Pentose phosphate pathway
xcb00500  Starch and sucrose metabolism
xcb00520  Amino sugar and nucleotide sugar metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
Module
xcb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_2465
   00030 Pentose phosphate pathway
    XC_2465
   00500 Starch and sucrose metabolism
    XC_2465
   00520 Amino sugar and nucleotide sugar metabolism
    XC_2465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcb04147]
    XC_2465
Enzymes [BR:xcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     XC_2465
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   XC_2465
  Exosomal proteins of other body fluids (saliva and urine)
   XC_2465
  Exosomal proteins of colorectal cancer cells
   XC_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI
Motif
Other DBs
NCBI-ProteinID: AAY49515
UniProt: Q4UTV8
Position
complement(2982376..2983890)
Genome map
AA seq 504 aa AA seqDB search
MTHTNGFDALHAHAQRLRGAAIPALLAAEPQRPTQYARQVGPLYFNFARQKYDRAALDAL
FAIARERDLAGAFQRLFRGEQVNVTEQRAALHTALRGDLTDAPVASDAYATAAEVRQRVG
ALIQQLEGTDVTDIVSVGIGGSDLGPRLVADALRAPSGARFRVHFVSNVDGAAMQRTLAT
LDPARTAGILISKTFGTQETLLNGSILHAWLGGSERLYAVSANPERAAKAFDIAPGRVLP
MWDWVGGRYSLWSAVGFPIALAIGFERFEQLLDGAAQFDAHVLNTPLEENVAVLHGLTAV
WNRNLLGSATHAVMTYDQRLALLPAYLQQLVMESLGKRVKLDGAAVDSDTVAVWWGGAGT
DVQHSFFQALHQGTSVVPADFIGTVHNDDPYAENHVALMANVLAQTEALANGQDSSDPHR
SYPGGRPSTVILLDALTPQALGALISMYEHSVYVQSVMWGINAFDQFGVELGKQLASQLL
PALKGEAADVADPVTRELLAKLRG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacacacaccaacggattcgacgcgcttcacgcccacgcccagcgcctgcgcggcgct
gccatccccgcattgcttgccgcagagccccagcggcccacgcagtacgcccggcaagtc
ggtccgttgtatttcaacttcgcgcggcagaagtacgatcgcgccgcgctcgatgcgctg
tttgcaatcgcacgcgagcgcgacctggcaggcgcgttccagcggctgttccgtggcgag
caggtcaatgtcaccgaacagcgcgccgccctgcacaccgcgctgcgtggtgatctcacc
gatgcaccggtcgcatccgatgcatacgccaccgctgccgaagtccggcagcgcgtgggc
gcgctgatccagcagctggaaggcaccgacgtcaccgacattgtcagcgtcggcatcggt
ggttccgatctgggcccgcgtctggtcgccgatgcattgcgtgcaccgtccggtgcgcgt
ttccgggtgcatttcgtttccaatgtcgatggcgcggccatgcagcgcaccctggcaacg
ctggacccggcacggaccgccggcatcctgatttccaagactttcggcacccaggaaacc
ctgctcaacggcagcatcctgcatgcgtggctcggtggcagtgagcgcctgtacgcagtg
agtgccaatcccgaacgtgccgccaaggcgttcgacattgcacctggccgcgtgctgccg
atgtgggactgggtgggcggccgttattcgctgtggtcggcggtcggtttcccgattgca
ctggcgatcggttttgagcgttttgaacaactgctcgacggtgccgcgcagttcgacgcg
catgtgctcaacacgccgctggaagaaaacgtggcagtgctgcacggactgaccgcagtg
tggaaccgtaacctgctcggtagcgccacgcatgcggtgatgacctacgaccagcgcctg
gccttgctgccggcgtatctgcagcagctggtgatggagagcctgggcaagcgcgtcaag
ctggacggcgcggccgtggacagcgacaccgtggcggtgtggtggggcggtgccggcacc
gacgtgcagcacagcttcttccaggcgctgcatcagggcaccagcgtggtgccggccgat
ttcatcggcaccgtgcacaacgacgacccgtacgcagaaaaccatgtcgcgctgatggcc
aacgtgctggcgcagaccgaggcgctggccaatggccaggacagcagcgacccgcaccgc
agttacccgggcggtcgcccgagcacggtgatcctgctcgatgcactcactccgcaggcg
ctgggtgcgctgatctcgatgtacgagcacagcgtgtacgtgcagtcggtgatgtggggc
atcaacgcgttcgaccagttcggcgtcgagctgggcaagcagttggccagccaattgctg
ccagccctgaagggcgaggccgccgatgtggccgacccggtcacgcgcgagctgttggcc
aagctgcgcggctaa

DBGET integrated database retrieval system