KEGG   Xanthomonas campestris pv. campestris 8004: XC_2470Help
Entry
XC_2470           CDS       T00247                                 

Definition
(GenBank) polynucleotide adenyltransferase
  KO
K00970  poly(A) polymerase [EC:2.7.7.19]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    XC_2470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:xcb03019]
    XC_2470
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     XC_2470
Messenger RNA biogenesis [BR:xcb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     XC_2470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PolyA_pol PolyA_pol_arg_C PolyA_pol_RNAbd FXR_C1
Motif
Other DBs
NCBI-ProteinID: AAY49520
UniProt: A0A0H2X8G1
Position
complement(2986566..2987933)
Genome map
AA seq 455 aa AA seqDB search
MGNPETRNGSATIEPSVTSPFTLRVIPRDQHTISRKDISPNALRVLYRLRESGFGAYLVG
GAVRDLLVGGHPKDFDVATSATPEEVKALFRNCRLIGRRFRLAHVVFGREIIEVATFRAN
IDDGSGDRELDNGRLVRDNVYGTIEDDAIRRDFTCNALYYAIEDFSVRDYCGGFEDVQAR
LMKLIGDPELRYQEDPVRMLRAVRLAAKLNFDIEAGTAEPIPRLAGLLSEAAPARLFEEI
LKLFLSGHGVASFEGLERYGLLGALFPESAAALKSNRSGALRAMVLEGLRNTDARVANDE
PVSPAFLFALLLWPAFCRTLMGLQAQGVQPEDAQRRAADRVTLHQLERVALPRRFSLPMQ
EIWLLQTRFSSRQRKRVFRTLSHPRFRAAFDFLVLRQFASADHAADVEFWRDAQQSSGQE
LVDAIENAQADHDGDESAPRKRRRRRRRTGAAAGE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
ttgggcaatcctgaaacacgaaacggaagcgccaccatcgaaccttcagttacatccccg
ttcacgctgcgcgtcatcccacgcgaccagcacaccatctcgcgcaaggacatcagcccc
aacgcgttgcgcgtgctgtaccgcctgcgcgaatccggctttggcgcctacctggttggt
ggtgcggtgcgcgacctgctggtcggcggccaccccaaggacttcgacgtggccaccagc
gccacgccggaggaagtcaaggcgctgttccgcaattgccgcctgatcggccgccgcttc
cgcctggcgcatgtggtgttcggccgcgagatcatcgaagtcgccaccttccgcgccaat
atcgatgacggcagcggtgaccgcgagctggataacggccgcctggtgcgcgacaacgtc
tacggcaccatcgaagacgatgcgatccgccgcgacttcacctgcaacgcgctgtattac
gcgatcgaggatttctcggtgcgcgattactgcggcggcttcgaagacgtgcaggcgcgc
ttgatgaagttgatcggcgacccggagctgcgctaccaggaagatccggtgcgcatgctg
cgcgcggtgcgcctggcggccaagttgaacttcgacatcgaagccggcaccgccgagccg
atcccgcgcctggccgggctgttgtccgaagcggcgcccgcgcgtctgttcgaagaaatt
ctcaagctgttcctgtccgggcacggcgtggccagtttcgagggcctggagcgttatggc
ctgcttggggcgctgttccccgaaagtgcagccgcgctcaagtccaaccgcagcggcgct
ttgcgcgcgatggtgctggaaggcctgcgcaacaccgatgcacgcgtggccaatgatgag
ccggtgtcgccggcgttcctgttcgcgctgctgctgtggccggcgttctgccgcaccctg
atggggctgcaggcgcagggcgtgcagccggaagatgcgcagcgtcgcgccgccgatcgg
gtgaccttgcaccagctggagcgggtggccctgccgcgccgcttctcgctgccgatgcag
gaaatctggctgctgcagacccggttttcctcgcgccagcgcaaacgcgtgttccgcacc
ttgtcgcacccgcgcttccgggccgcgttcgacttcctggtgctgcgccagttcgcctcg
gccgaccatgccgccgatgtcgagttctggcgcgatgcgcagcagtcgtccggccaggag
ctggtggacgcgatcgagaacgcgcaggccgatcacgacggagatgagtcggcaccgcgc
aagcgtcgccgccgccgccgtcgtaccggcgccgccgcaggcgagtag

DBGET integrated database retrieval system