KEGG   Xanthomonas campestris pv. campestris 8004: XC_2471Help
Entry
XC_2471           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00790  Folate biosynthesis
xcb01100  Metabolic pathways
Module
xcb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XC_2471
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     XC_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1 DUF2695
Motif
Other DBs
NCBI-ProteinID: AAY49521
UniProt: Q4UTV2
Position
complement(2988441..2989376)
Genome map
AA seq 311 aa AA seqDB search
MSTTLPDIAVTEPSALHAPLRWVGMQDIAIPVRLDEAEPSGTVAARAQVQVDLPRPELKG
IHMSRLYRLLDRHLEQPLSPAMLSQLLQAMIDSHADCGSRAARVSLAFEVMLRMPALRSE
GLAGWRAYPVRIDAQSRAGRSEMRLQIDVLYASTCPCSAALSRQLLSKAFAQQHAGQTAL
RVEDVAQWLQRNGSYATPHSQRSVAQVRVDLVARVQSFDIRALVLLCESALATPVQAAVR
RIDEQAFARLNGANLMYVEDAARRLRKELAERYASFHVAVRHFESLHAHDAVAETGSDAD
VFHMIAESHGQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacgcttcccgatatcgccgtcaccgaaccttccgcgctgcatgcgccctta
cgctgggttggcatgcaggacattgcgattcccgtgcgcctggacgaggccgagccgagt
ggcacggtggctgcgcgcgcgcaggtgcaggtcgatctgccgcggcccgaactcaagggt
atccacatgtcacggctgtatcgcttgctggatcggcatctggagcaaccgctatcaccg
gcgatgctctcgcagttgctgcaggcaatgatcgacagccatgccgattgcggcagccgt
gcggcgcgggtgagtctggccttcgaagtgatgttgcggatgccggcactgcgcagtgag
ggactggccggttggcgtgcctatccggtgcgcatcgacgcacagagcagggcggggcgc
agtgagatgcgtctgcagatcgatgtgctgtatgcctccacctgcccgtgttcggccgcg
ctatcacgtcagttgttgagcaaggccttcgcgcaacagcatgctggacagaccgctttg
cgggtcgaggatgtcgcgcagtggctgcaacgcaacggctcgtatgccacgccacatagc
cagcgcagcgtggcgcaagtgcgcgtggacttggtggcgcgcgtgcagagtttcgacatc
cgcgcgttggtgctcttgtgcgaaagcgcattggccacgccagtacaggcagcggtgcgg
cggattgatgagcaggcatttgcacgcttgaacggtgccaacctgatgtacgtggaagat
gccgcgcgccggctccgcaaggagttggccgagcgctatgcctcatttcatgtggcggtc
cgccatttcgaaagcctgcacgcgcacgacgcggttgccgaaactggcagtgatgcagac
gtcttccacatgattgccgagtcgcacggtcagtga

DBGET integrated database retrieval system