KEGG   Xanthomonas campestris pv. campestris 8004: XC_2476Help
Entry
XC_2476           CDS       T00247                                 

Definition
(GenBank) MFS transporter
  KO
K08139  MFS transporter, SP family, sugar:H+ symporter
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcb02000]
    XC_2476
Transporters [BR:xcb02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    XC_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12
Motif
Other DBs
NCBI-ProteinID: AAY49526
UniProt: A0A0H2X8G4
Position
complement(2993567..2995012)
Genome map
AA seq 481 aa AA seqDB search
MFPGEPMSSVSIDGAPDAGENTRFIILISCVATIGGFLFGFDSGVINGTVDGLKQTFQSS
AAETGFEVASMLLGCAIGAFFAGRLVDRWGRRAVLIISAALFLLSAIGAGASHSSGFFIF
ARVMGGFAVGAASVISPAYIAEVASARYRGRLATMQQIAIISGLFCAFLSNYLLANAAGA
STEPLWGGQAAWRWMFWMQAIPSLLFLLLLLVIPESPRYLVVKGRREQALVVLKRLYGNA
AAQTKLGEISASMSADQHKPKFSDLISKTTGKIRPIVWIGVGLAVFQQLVGINVVFYYGA
VLWQAVGFSEQDALLINVLSGGLSIGACLVTVMLVDKIGRKPLLWIGSAGMAVSLALVTY
AFATASLDPNGKLAMSDAMGMLALVAANVYVVFFNASWGPVMWVMLGEMFPNQIRGSGLA
IAGAAQWTSNFAITVSFPILLGSIGLAGAYGIYTVAAFISVFFVLKYVYETKGKELEQME
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaggtgaacccatgtccagtgtctccattgacggcgcccccgatgccggcgag
aacacccgtttcatcatcctgatcagctgcgtggccacgatcggcggctttctgttcggc
ttcgacagtggcgtgatcaatggcaccgtcgacgggctcaagcagaccttccagtccagc
gccgccgagaccggcttcgaagttgcctcgatgctgctggggtgcgccatcggcgccttc
tttgccggccgcctggtcgaccgctggggccgccgtgctgtcctgatcatttctgcggcg
ctgttcctgctctcggctatcggtgccggtgcctcgcacagctccggcttcttcatcttt
gcccgcgtgatgggcggctttgcggtaggcgcagccagcgtcatttcgccggcctacatc
gccgaggttgcctccgcgcgctatcgcggccggctcgccaccatgcagcagatcgccatc
atcagcgggctgttctgcgcgttcttgagcaactacctgctggccaatgccgccggtgcg
tccaccgagccgttatggggcgggcaggcggcctggcgctggatgttctggatgcaggcc
atcccgtcgctgctgttcctgctgctgttgctggtcatccccgaaagcccgcgctacctg
gtggtcaagggccgtcgcgagcaggcgctggtggtgctcaagcggctgtacggtaacgcg
gccgcgcagaccaagctgggcgaaatctccgcctcgatgtcggccgaccagcacaagccc
aagttctccgacctgatcagcaagaccaccggcaagatccgcccgatcgtatggattggc
gtcggcctggcggtgttccagcaactggtcggcatcaacgtggtgttctattacggcgcg
gtgctgtggcaggcagtgggcttctccgaacaggacgccttgctgatcaacgtgctctcc
ggcggcctcagcattggtgcctgcctggtcacggtgatgctggtcgacaagatcggccgc
aagccgttgctgtggatcggctcggccggtatggcggtatcgctggcactggtgacctac
gccttcgccaccgcctcgctggatcccaacggcaagctcgcgatgtccgatgccatgggc
atgctcgcgctggttgccgccaacgtctacgtggtgttcttcaatgcctcgtggggcccg
gtgatgtgggtgatgctgggcgagatgtttcccaaccagatccgcggttcgggcctggcc
attgccggcgctgcacagtggacttccaacttcgccatcaccgtcagcttcccgatcctg
ctcggcagcatcggtcttgccggcgcctacggcatctacaccgttgccgccttcatctcg
gtgttcttcgtgctcaagtacgtctacgagacgaagggcaaggagctggagcagatggag
ggctga

DBGET integrated database retrieval system