KEGG   Xanthomonas campestris pv. campestris 8004: XC_2480Help
Entry
XC_2480           CDS       T00247                                 

Definition
(GenBank) alpha-xylosidase
  KO
K01811  alpha-D-xyloside xylohydrolase [EC:3.2.1.177]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XC_2480
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.177  alpha-D-xyloside xylohydrolase
     XC_2480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 DUF5110 DUF4968 PA14 Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: AAY49530
UniProt: A0A0H2XA05
Position
complement(3000402..3003239)
Genome map
AA seq 945 aa AA seqDB search
MALSLALLANAAYAQEVRKAADGVTVMPSAKGAAAVRLQVVDAGIIRVSADPDGDFARTP
SLMRVPVQGDTAFQVAEQGDSVQLKTGKVTATVSTVDGHVSFADANGKPVLSEVAGGRSF
APLKVEGKQYLSVRQRFQSPDDEGLYGFGQHQQGWMNQKGRNVELQQNNIDMAVPYLVSS
RNYGLLWDNNSITRLGDPRGLQPLPKSLKLYDAKGKSGALTARYAINGKQVLERRESEVN
YQYLSDLTKFPKKAITKDKDSRMQVTWEGEIEALTGGEHTFSLYSSEYAKLYVDGKLVID
RWRQNWNPWNHEFKLDLEPGTRHTVKIEWDLIDPSYIALLHRDPLPATEAKDLSLWSEAG
QMIDYYFVSADSYDQAVAGYRELTGKSVMLPKWAYGFWQSRERYKSQDELVGAVAEYRKR
KLSLDNIVLDWSYWPENAWGSHDFDPQHFPDPDGMVKAVHDMHAQIMISIWPKFYPTTAN
YKELDAAGFMFKRNVEVGELDWIGKGYKNSFYDPYSEKAQAIYWRQINEKLNSKGFDAWW
MDADEPDVHSNLDIGERKARTTPTALGPSTEFFNSYPLPHTHGVYVGDRAADDKRVFILS
RKGYAGTQRNAVAVWSGDIVSRWDDMHDQISAGVNMALSGLPNWTFDIGGFAVEKRYENQ
DPAHLPEWRELNTRWFQFGAFVPIFRSHGQFPYREIWNIAPEGTPFYESMAYYNRLRYAL
LPYIYSLAGDTYQRDGVIMRGMMMDFPDDAKARDINDQYLFGPAFLVAPVTRFGATSRQV
YLPAGSSWLDFATGKRYEGGQTIEAAAPIERMPLFVRAGSIVPTGPVQEYVDQKPDAPLT
VVVYTGANGQFSLYEDDGKGYGYEKGEFSRIPLSWDQAKGELRIGQREGSWTGMQAKRTI
NVRFVDGPREDAGALEPKVDTSIQYDGKPVSVLQRKIAPGKARRR
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgtcgttggccttgttggccaatgccgcgtatgcgcaggaagtgcgcaaggcc
gccgacggcgtcaccgtgatgccgagcgccaagggtgccgcagcggtgcgtctgcaggtg
gtcgatgccggcatcatccgcgtcagtgccgatcccgatggcgacttcgcgcgcacgccc
agcctgatgcgcgtgccggtgcagggcgataccgccttccaggtggccgagcagggcgac
agcgtgcagctgaagaccggcaaggtcaccgccaccgtgtccaccgtcgatggccatgtc
agcttcgccgatgccaatggcaagccggtgttgtccgaagtggccggcgggcgcagcttt
gcgccgctgaaagtggaaggcaagcagtacctgagcgtgcgtcagcgtttccagtcgccc
gatgacgaaggcttgtacggcttcggccagcaccagcagggctggatgaaccagaagggc
cgcaacgtcgagctgcagcagaacaacatcgacatggcggtgccgtacctggtgtccagc
cgcaactacggcctgctgtgggacaacaactcgatcacccgcctgggcgatccgcgcggc
ctgcagccgctgcccaagtcgctcaagttgtacgacgccaagggcaagtccggtgcactg
accgcgcgctacgccatcaatggcaagcaggtgctggaacgccgcgagagcgaagtgaat
taccagtacctcagcgacctgaccaagttcccgaagaaggcgatcaccaaggacaaggac
agccgcatgcaggtcacctgggagggcgagatcgaagcgctcaccggtggcgagcacacc
ttctcgctgtactcgagcgagtacgccaagctgtacgtggacggcaagctggtgatcgat
cgctggcgccagaactggaacccctggaatcacgagttcaagctggatctggagcccggc
acgcggcacaccgtcaagatcgaatgggatctgatcgaccccagctacatcgcgctgctg
caccgcgacccactgcccgccaccgaggcgaaggatctctcgctgtggtccgaagccgga
cagatgatcgactactacttcgtctcggccgactcctacgaccaggccgtggccggttac
cgcgaactcaccggcaagtcggtgatgctgccgaagtgggcgtatggcttctggcagagc
cgcgagcgctacaagagccaggacgaactggtgggcgcggtggccgaataccgcaagcgc
aagctgtcgctggacaacatcgtgctcgactggtcgtactggccggaaaacgcctggggc
tcgcatgatttcgatccgcagcatttcccggacccggacggcatggtcaaggccgtgcac
gacatgcacgcgcagatcatgatttcgatctggcccaagttctatcccaccaccgccaac
tacaaggaactggacgcggcgggtttcatgttcaagcgcaacgtcgaagtcggcgagctg
gactggatcggcaagggctacaagaactcgttctacgacccgtactccgaaaaggcccag
gccatctactggcgccagatcaacgaaaagctcaacagcaagggcttcgatgcctggtgg
atggacgccgacgagccggacgtgcattccaacctggacatcggtgagcgcaaggcacgc
accacgccgaccgcgttgggcccttcaaccgagttcttcaattcgtatccgttgccgcac
acgcacggcgtgtacgtgggtgaccgcgccgccgacgacaagcgcgtgttcatcctctcg
cgcaagggctatgccggcacgcaacgcaatgcagtggcggtatggagcggcgacatcgtc
tcgcgttgggacgacatgcacgaccagatttccgccggcgtgaacatggcgctgtcgggc
ctgccgaactggaccttcgacatcggcggctttgcggtggagaagcgttacgaaaaccag
gacccggcgcatctgccggaatggcgcgaactcaacacgcgctggttccagttcggtgcg
ttcgtgccgatcttccgctcgcatggccagttcccgtaccgcgagatctggaacatcgcc
ccggaaggcacgccgttctacgagagcatggcctactacaaccgcctgcgttacgccctg
ctgccgtacatctacagcctggccggcgatacctaccagcgtgacggcgtgatcatgcgc
ggcatgatgatggacttcccggatgacgcgaaggcacgcgacatcaacgaccagtacctg
ttcggcccggcattcctggtcgcaccggtgacccgcttcggcgcgacctcgcggcaggtg
tatctgccggccggcagcagctggctggatttcgccaccggcaagcgctacgagggtggc
cagaccatcgaggccgccgcgccgatcgaacgcatgccgctgttcgtgcgtgccggctcc
atcgtgcccaccggcccggtgcaggagtacgttgaccagaagccggatgcgccgctcacc
gtggtggtctacacgggtgccaatggtcagttctcgttgtatgaggacgacggcaaaggc
tatggctacgagaagggcgagttcagccgcattccgctgagctgggaccaggccaagggc
gagctgcgcatcggccagcgcgaaggcagctggaccggcatgcaggccaagcgcaccatc
aatgtgcgttttgtcgacggaccgcgtgaggacgccggtgcgctggagcccaaggtggac
accagcatccagtacgacggcaagccggtcagcgtgttgcagcgcaagattgcgcccggc
aaagcgcgtcgtcgatga

DBGET integrated database retrieval system