KEGG   Xanthomonas campestris pv. campestris 8004: XC_2498Help
Entry
XC_2498           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY49548
UniProt: A0A0H2X8H8
Position
3026397..3026492
Genome map
AA seq 31 aa AA seqDB search
MGACDGGAAFWGALYDPQTGAFSEIAINGGA
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcctgtgatggcggggctgccttctggggcgcgttgtacgacccgcaaactggc
gcgttctcggaaatcgccatcaacggcggcgcctga

DBGET integrated database retrieval system