KEGG   Xanthomonas campestris pv. campestris 8004: XC_2505Help
Entry
XC_2505           CDS       T00247                                 

Definition
(GenBank) hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY49555
UniProt: A0A0H2X8G0
Position
3034736..3034873
Genome map
AA seq 45 aa AA seqDB search
MRGHTQGPANSRIARRHALMPFDTGTAMHGNSSQHHAIRNSKMPA
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtcatacccagggcccagcgaacagccgcattgcacgccggcacgcgctgatg
ccgttcgacaccggcaccgcaatgcatggcaacagcagccaacaccacgccatccgcaac
tccaagatgcctgcatag

DBGET integrated database retrieval system