KEGG   Xanthomonas campestris pv. campestris 8004: XC_2507Help
Entry
XC_2507           CDS       T00247                                 

Definition
(GenBank) alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00970  Aminoacyl-tRNA biosynthesis
Module
xcb_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XC_2507
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xcb01007]
    XC_2507
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcb03016]
    XC_2507
Enzymes [BR:xcb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     XC_2507
Amino acid related enzymes [BR:xcb01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   XC_2507
Transfer RNA biogenesis [BR:xcb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    XC_2507
 Prokaryotic Type
    XC_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD Snapin_Pallidin
Motif
Other DBs
NCBI-ProteinID: AAY49557
UniProt: Q4UTR6
Position
complement(3035644..3038292)
Genome map
AA seq 882 aa AA seqDB search
MNAPAKFSTSQIRSDFLAFFEGKGHTIVPSAPLVPGNDPTLLFTNSGMVQFKDVFLGAEK
RSYVRAADVQRCLRAGGKHNDLDSVGYTARHHTFFEMLGNWSFGDYFKKDAIAWAWELLT
QVWKLPADRLLVTVYHTDEEAFELWRDMIGIPESRIVRIGDNKGAPYASDNFWQMADTGP
CGPCTEIFFDHGDHIAGGPPGSPDEDGDRFIEIWNLVFMQFDRQPDGTLVPLPAPCVDTG
MGLERLAAILQHVHTNYEIDVFQALIGKASALTGIADLENKSLRVIADHIRACSFLIVDG
VLPSNEGRGYVLRRIIRRALRHGWMLGVRQLFFSKMVPTLVELMGEAYPELVVAQETVAR
ALLAEEERFAETLDAGMKIFDDVASRSQEIIPGADAFRLYDTYGFPVDLTADIARERGMR
VDMEGFEFAMERQRETARAAGKFGGGVALPADLVATMAPTVFLGYEAQDADALKVVALLK
QGRPVDRAEAGDEVIVFTDRTPFYAESGGQVGDSGQLSGTDVSIEVADTQKFAGQFHGHV
GRIAEGALKLGDVLSGGIDVQRRGKTILNHSATHLLHAALREVLGTHVQQKGSLVAPDRL
RFDFSHFQPITAEELAVIERKVNAEVRTNHSVEVHNMAMQEALDFGAMALFGEKYGERVR
VLKMGGYSTELCGGTHVSRTGDIGLFKITSEGGVSSGVRRIEAVTGQGALDYVAEEERRL
GEAANLLGGNSTEIVDKVRALTDRQKRLERELESLKAKLASGATADLGASAVDVAGVKVI
AVRLEGFDAKALREAMDRLKQQLGDSVIVLAGAAGGKVALVAGVNGGPTGKVKAGELLGH
IASQIGGKGGGRPDLAQGGGEDGPALATALQGVPSWVKQHLG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccgccaaattcagcacttcccagatccgtagtgacttcctcgcgttcttc
gaggggaagggccacaccatcgtgccatccgcgccgctggtgccgggcaacgatccaacc
ttgctgttcaccaattccggcatggtccagttcaaggatgtcttccttggcgcggaaaag
cgcagctacgtgcgtgccgcggacgtgcagcgctgcctgcgtgccggtggcaagcacaac
gatctggattcggtgggctacaccgcgcgccaccacaccttcttcgagatgttgggcaac
tggtcgttcggtgattacttcaagaaggacgccattgcctgggcgtgggagctgctgacg
caggtctggaagctgccggctgatcgcttgctggtcacggtgtaccacaccgacgaagag
gcctttgaactctggcgcgacatgatcggcatcccggaaagccgcatcgtgcgcatcggc
gacaacaagggcgcgccgtatgcctcggacaacttctggcagatggccgacaccggtccc
tgcggtccgtgcaccgaaattttcttcgatcatggcgatcacatcgccggcggcccaccg
ggttcgcccgatgaagacggcgaccgcttcatcgaaatctggaacctggtgttcatgcag
ttcgatcgccagccagacggcaccctggtgccgttgccggccccgtgcgtggataccggc
atgggcctggagcggctggccgccatcctgcagcacgtgcacaccaattacgaaatcgac
gtcttccaggcgctgatcggtaaggccagcgcgctgaccggcattgcggatctggaaaac
aagtcgctgcgggtgatcgccgatcacatccgcgcctgttcgttcctgatcgtggatggc
gtgttgccatccaatgaagggcgtggctatgtgctgcgccggatcatccgtcgcgcgttg
cggcatggctggatgctgggcgtccgccagctgttcttcagcaagatggtgcccacgctg
gtcgagctgatgggcgaggcctatcccgagctggtggtcgcgcaggagaccgtggcgcgt
gcgttgctggccgaagaagaacggtttgccgagacgctcgacgctggcatgaagatcttc
gatgacgtcgcgtcgcgctcgcaggagatcattccgggcgcggatgcgttccgtctttac
gacacctacggcttcccggtcgatctcaccgccgacatcgcacgtgagcgcggaatgcgc
gtggacatggagggctttgagttcgccatggagcgtcagcgcgaaaccgcgcgcgcggca
ggcaaattcggtggcggcgtggcgctgcctgcggatctggtggccaccatggcgccgacc
gtgttccttggctacgaagcccaggatgctgacgcgctgaaggtcgtcgcgttgctcaag
caggggcggccggtggaccgtgccgaggccggtgatgaggtcatcgtgttcaccgatcgc
acgccgttctacgccgaatctggcggccaggtcggcgacagcggtcagctcagcggcacg
gacgtcagtattgaggtcgccgacacacaaaagttcgctggccaattccatgggcatgtc
gggcgtatcgcggagggcgcactgaaacttggcgacgtgttgtccggtggtatcgatgtg
cagcgtcgtggcaagaccatcctcaaccactcggccacgcatctgctgcatgccgcgttg
cgcgaggtgctggggacccacgtgcagcagaagggctcgctggtggcgccggatcgcctg
cgctttgacttctcgcatttccagccgatcactgcggaagaacttgcagtgatcgagcgc
aaggtcaatgcggaagtgcgcaccaaccacagcgttgaagtgcacaacatggccatgcag
gaggccctggacttcggtgcgatggcgctgtttggcgaaaagtatggcgagcgcgtacgc
gtgctcaagatgggcggctattcgaccgaactgtgcggcggcacccatgtcagccgcacc
ggtgacatcggcttgttcaagatcacctctgaaggcggcgtctcttccggcgtgcgccgc
atcgaagcggtgacagggcagggcgcactcgactacgtggctgaagaggagcgtcgtctg
ggtgaggccgcaaacctgctcggcggcaacagcaccgagatcgtcgacaaggtgcgggcg
ctgaccgatcgccagaagcgcctggagcgcgagctggagtcgctcaaagccaagcttgca
tccggcgcgaccgccgacctcggcgccagcgcggtggacgtggcaggcgtcaaggtgatt
gcggtgcgccttgagggattcgacgccaaggcgttgcgcgaggccatggatcgcctgaaa
caacaattgggcgactcggtgatcgtgctggccggcgctgcaggcggcaaggtcgccctg
gtggccggcgtgaacggcggcccaactggcaaggtgaaggcaggggaactccttggccat
atcgccagtcagatcgggggcaagggcggtggccgtccggatctcgcccagggtggtggc
gaggacgggcccgcccttgcgactgcgctccaaggcgtgccctcctgggtcaagcaacac
ttgggctga

DBGET integrated database retrieval system