KEGG   Xanthomonas campestris pv. campestris 8004: XC_2510Help
Entry
XC_2510           CDS       T00247                                 

Definition
(GenBank) LexA
  KO
K01356  repressor LexA [EC:3.4.21.88]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xcb01002]
    XC_2510
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xcb03400]
    XC_2510
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.88  repressor LexA
     XC_2510
Peptidases [BR:xcb01002]
 Serine Peptidases
  Family S24: LexA family
   XC_2510
DNA repair and recombination proteins [BR:xcb03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    XC_2510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LexA_DNA_bind Peptidase_S24 MarR_2 HTH_20 FaeA Rrf2 HTH_12
Motif
Other DBs
NCBI-ProteinID: AAY49560
UniProt: A0A0H2XA28
Position
complement(3040202..3040843)
Genome map
AA seq 213 aa AA seqDB search
MDLTDTQQAILALIAERIETDGVPPSQTEIARAFGFKGVRAAQYHLEALEQAGAIRRVPG
QARGIRLAGAAAHARAAPAEEPVRDDVLRLPVLGRVAAGLPIGADIGSDDFVVLDRVFFS
PSPDYLLKVQGDSMRDEGIFNGDLIGVHRTRDARSGQIVVARIDEEITVKLLKIGKDRIR
LLPRNPDYAPIEVLPDQDFAIEGLYCGLLRPNR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaccgatacccagcaagcaatcctcgccctcatcgccgagcggatcgagacc
gatggcgtaccgccctcgcagaccgagatcgcgcgggcattcggcttcaagggcgtgcgc
gccgcgcaataccatctggaggcgctggagcaggccggcgccatccgtcgcgtgccgggc
caggcgcgtggtatccggcttgccggcgccgctgcgcacgccagggccgcccctgcagag
gagccggttcgcgatgacgtgctgcgcttgccggtgctggggcgcgtggcggccgggctg
ccgatcggtgccgacatcgggtcggacgatttcgtggtgctggaccgggtcttcttctcg
ccatcgccggattacctgctcaaggtgcagggcgattcgatgcgcgacgaaggcatcttc
aacggcgacctgatcggcgtgcatcgcacccgcgacgcccgctcggggcagatcgtggtg
gcccggatcgacgaagagatcaccgtcaagctgctcaagatcggcaaggaccgcatccga
ctgctgccgcgcaatccagactacgcgccgatcgaagtgctgccggatcaggatttcgcc
atcgagggcctgtattgcggcctgttgcggcccaaccgttga

DBGET integrated database retrieval system