KEGG   Xanthomonas campestris pv. campestris 8004: XC_2520Help
Entry
XC_2520           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07574  RNA-binding protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xcb03009]
    XC_2520
Ribosome biogenesis [BR:xcb03009]
 Prokaryotic Type
  Other maturation factors
   XC_2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRS1_YhbY
Motif
Other DBs
NCBI-ProteinID: AAY49570
UniProt: A0A0H2X8I9
Position
3053547..3053852
Genome map
AA seq 101 aa AA seqDB search
MSIVLTSAQNRFLRGQAHDLKALLQTGGKGVTPAFVAELEDVLERHELIKVKVAAEDRET
RDALIAEIIEHTGCALVQRIGHVAILYRPSKEKRQIVLPRG
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgttctaacctccgcccagaaccgtttcctgcgcggccaggcccatgatctc
aaagcactgctgcagaccggcggcaagggcgtcacgccggcgttcgtggccgagctggaa
gatgtgctcgaacgccacgagctgatcaaggtgaaggtggcagcggaagaccgtgaaacc
cgcgacgcgttgatcgccgagatcatcgaacacactggctgcgcgctggtgcagcgcatc
ggccatgtcgccatcctgtaccgccccagcaaggaaaagcgacagatcgtgctgccgcgc
ggctga

DBGET integrated database retrieval system