KEGG   Xanthomonas campestris pv. campestris 8004: XC_2521Help
Entry
XC_2521           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF498
Motif
Other DBs
NCBI-ProteinID: AAY49571
UniProt: A0A0H2XA64
Structure
PDB: 

Position
3053869..3054243
Genome map
AA seq 124 aa AA seqDB search
MPLNQEHPDYTYALRAADGRHAKVNEQILQQSFILMPDELVEHWPVPSLGQLQPAHMDAV
LALNPAVILLGTGERQQFPSTDVLAACLTRGIGLEAMTNAAAARTYNVLASEGRRVALAM
IVGG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaaccaggaacaccccgactacacttacgcgctacgcgcggccgatggccgc
cacgccaaggtgaacgagcagattctgcagcagagtttcatcctgatgcccgacgagctg
gtggaacactggcccgtcccctcgctcggccagctgcagcctgcccacatggacgccgtg
ctggcgctgaacccggcagtgatcctgctgggaaccggcgagcgccagcagttcccgtct
acggatgtcctggccgcctgcctgacccgcggcatcggcctggaagccatgaccaacgcg
gcggcggcacgcacctacaacgtgctggccagcgaaggccgccgggtggcgctggcgatg
atcgtaggcgggtga

DBGET integrated database retrieval system