KEGG   Xanthomonas campestris pv. campestris 8004: XC_2527Help
Entry
XC_2527           CDS       T00247                                 

Definition
(GenBank) hydrogenase subunit
  KO
K06176  tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcb03016]
    XC_2527
Enzymes [BR:xcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     XC_2527
Transfer RNA biogenesis [BR:xcb03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    XC_2527
 Prokaryotic Type
    XC_2527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruD RST
Motif
Other DBs
NCBI-ProteinID: AAY49577
UniProt: Q4UTP6
Position
complement(3058190..3059293)
Genome map
AA seq 367 aa AA seqDB search
MSDSPVLPRAHGAAVLTAAMRSVAEDFQVDELPAFDASGEGEHLLLTVRKRGQNTAYVAK
RLAQWAGIAEMGIGYAGLKDRHAVTTQRFSVHLPKRIAPDLSALDDDDMQVVEHTWHNRK
LQRGALHGNRFVLTLREVVGDQAVIDARLHAIAARGIPNWFGEQRFGRDGGNVAAALAMF
GHTRQPDGTLAPAPKRRLRNDQRSLLLSAARSALFNQVLTARVEQGNWDAPLDGEAWMLD
GSRSVFGPEPWSEVLAERLARFDIHPSGPLWGAGELRCSADAAAIEQAALSDPQSLALRT
GLEAAGLKQERRALRLRPQGLAHAWLDAQTLQLTFALPPGCYATAVLWELGEVVDAARVA
PQSRSEG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcacccgttttgccgcgcgcgcatggcgccgcggtgctcactgcggcaatg
cgcagcgttgccgaggatttccaggttgatgagttgcccgcgttcgatgcatcgggtgaa
ggcgagcatctgctgctgaccgtgcgcaagcgtggccagaacaccgcttacgtggccaag
cgtttggcgcagtgggccggcattgcggagatgggcattggctacgcgggtctgaaggac
cgccacgcggtgaccacgcaacgcttcagcgtgcatctgcccaagcgcatcgccccggac
ctgagtgcgctggacgatgacgacatgcaggtggtggagcacacctggcacaaccgcaag
ctgcagcgcggcgccttgcacggcaatcgcttcgtgctgacgctgcgtgaggtggtgggc
gatcaggcggtcattgatgcgcgcctgcacgcgatcgctgcgcgcggcatccccaactgg
tttggcgagcagcgcttcggccgcgatggtggcaatgtcgccgcggcattggcgatgttc
ggtcacacgcggcagccggatggcacgctcgcgcccgcacccaaacggcgcctgcgcaac
gatcaacgctcgctgctgttgtcggcagcacgctcggcactgttcaaccaggtgctgact
gcgcgcgtggaacagggcaattgggatgcgccactggacggcgaggcctggatgctggac
ggctcacgcagcgtgttcggtcccgaaccctggagcgaggtgttggccgagcgtctggcg
cgtttcgacattcatcccagcggcccgttgtggggcgccggcgaattacgctgcagcgct
gatgccgcggcgattgaacaggcggcactgtcggatccgcaatcgcttgcgttgcgcacg
ggcctggaagcggccggcctcaagcaggagcgccgcgcgctgcggctgcgtccgcagggg
ttggcacatgcctggctggacgcgcagacgctgcagctcaccttcgccttgccaccgggc
tgctacgcgactgcggtgttgtgggaactgggcgaggtcgtcgatgcagcgcgcgttgca
ccgcagtcgcgttccgagggctga

DBGET integrated database retrieval system