KEGG   Xanthomonas campestris pv. campestris 8004: XC_2529Help
Entry
XC_2529           CDS       T00247                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00900  Terpenoid backbone biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XC_2529
Enzymes [BR:xcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     XC_2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspD NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAY49579
UniProt: Q4UTP4
Position
complement(3059886..3060683)
Genome map
AA seq 265 aa AA seqDB search
MTGSVWAIVPAAGRGTRFGGAVPKQYLHAAGQPLMAYTLAALAAHPAVAGIVVAIAPDDA
DWPGWTAVHAKPVLTCVGGATRAASVLAGLLALPDGVRADDFVLVHDAARPNLALADLDR
LLEIGRGDPVGAILAAPVRDTLKRAGDDGGIDGTEPRERLWRALTPQLFRRHQLIRGLTE
ASAAGVDVTDEAMAIERLGLRPLLVEGAEDNFKVTTPADLARFEFELANRDRGGASREAE
RSAMPSAATSVFSGARSAASGSEEV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccggctcggtgtgggcgattgtcccagcggccgggcgtggcacgcgcttcggcggt
gcggttcccaagcaatacctgcacgcagcgggccagccgctcatggcctacacgttggcg
gccttggcagcacatccggcggtggccgggatcgtggtggcgattgctcccgacgatgcc
gactggccgggctggacagccgtgcacgccaagcccgtgctcacctgcgtgggcggcgcc
acgcgtgcggcgtcggtgctggccgggttgctggcgttacccgatggcgtgcgcgccgat
gactttgtgctggtgcacgatgcggcccggcccaacctggcgctggccgatctggaccgg
ttgctggagattggccgcggcgatccggtcggtgccattttggccgcgccggtgcgcgat
acgctcaaacgcgcaggcgacgatggcgggatcgatggcactgagccgcgcgagcggttg
tggcgcgcgttgacgccacagttgttccggcgccatcagttgatccgcggcctcaccgag
gcatcggctgccggcgtggacgtgaccgacgaggcgatggcgatcgagcggcttggcttg
cgtcccttgctggtggaaggtgccgaagacaacttcaaggtgaccacgcctgcggacctg
gcgcgttttgaattcgagctggcgaaccgcgaccgcggtggcgcaagccgggaggctgag
cgcagcgctatgccctccgctgcaacgtccgttttttccggtgcgcgttctgcggcgtcc
ggttccgaagaggtgtaa

DBGET integrated database retrieval system