KEGG   Xanthomonas campestris pv. campestris 8004: XC_2540Help
Entry
XC_2540           CDS       T00247                                 

Definition
(GenBank) transport protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    XC_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR Pilin_N
Motif
Other DBs
NCBI-ProteinID: AAY49590
UniProt: A0A0H2XA74
Position
complement(3071928..3073055)
Genome map
AA seq 375 aa AA seqDB search
MLTLVLVVILAALVFEFINGFHDTANSIATVVATKVLSPGWAVMLAAGMNLIGALTGTAV
ALTIASGLLNTNVVDVTPQVILCALLGGIIWNLITWWKGLPSSSSHALIGGLCGAGLAAA
HNNWDALIWSENIGNWAKNKGLLWKVFVPMITSPIAGFLLGIVVMLLLWALIAGMAKLGG
PIGRLARPRWVNAFFGKAQIASAAYMGYAHGHNDAQKTMGIIAMTLIGAQSAGALDDLPS
WLSFLHPGTGLAAGAGIPMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHPIHGFAAE
TSSATVLTVAAHFGMPVSTTHSISTAIMGVGFAKNPRSLRLGVIERIVWAWILTIPAAGG
VAYLILRGFELFGWT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccttgttctggtggtgatcctggcggcgctggtgttcgagttcatcaacggc
ttccacgacaccgccaactccatcgctaccgtggtagccaccaaggtgctctcgcccggc
tgggcggtgatgctggcggccggcatgaacctcatcggcgcgctcaccggcaccgccgtg
gcgctcaccatcgcctcgggcctgctcaacaccaacgtggtggatgtcactccgcaggtg
atcctgtgcgcgctgctgggcggcatcatctggaacctgatcacctggtggaaggggctg
ccgtcgtcgtcctcgcacgccttgatcggtgggctgtgcggtgccggcctggctgccgcg
cacaacaactgggatgcgctgatctggtcggaaaacatcggcaactgggccaagaacaag
ggcctgttgtggaaagtgttcgtgccgatgatcacctcgccgatcgccggcttcctgctg
ggcatcgtggtgatgctgctgctgtgggcgttgatcgccggcatggccaagctgggcggg
ccgatcggccggctggcgcgtccgcgctgggtcaacgcgttcttcggcaaggcgcagatc
gcctcggcggcctacatgggctacgcgcacggccataacgatgcgcaaaagaccatgggc
atcatcgcgatgaccctgatcggcgcgcagtcggccggtgcgctggacgatctgccgagc
tggctgtcgtttctgcatccgggcaccgggctggccgcgggtgccggcattccgatgtgg
atcgtgctgacctgcgcagtggtgatggctgccggcaccgcttcgggcggctggaagatc
atcaagacgctcggccacaagatggtcaagttgcaccccatccacggctttgcggcggaa
accagctcggcgaccgtgctcaccgtggccgcgcatttcggcatgccggtatcgaccacg
cacagcatttccactgcgatcatgggcgtgggctttgccaagaatccgcgctcgctgcgg
ctgggcgtgatcgaacgcatcgtctgggcctggatcctcaccatcccggctgccggtggc
gtggcgtatctgatcctgcgcgggttcgaactgttcggctggacctga

DBGET integrated database retrieval system