KEGG   Xanthomonas campestris pv. campestris 8004: XC_2542Help
Entry
XC_2542           CDS       T00247                                 

Definition
(GenBank) hemolysin
  KO
K03699  putative hemolysin
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:xcb02042]
    XC_2542
Bacterial toxins [BR:xcb02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   XC_2542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF21 CorC_HlyC CBS
Motif
Other DBs
NCBI-ProteinID: AAY49592
UniProt: A0A0H2XA47
Position
3073965..3075275
Genome map
AA seq 436 aa AA seqDB search
MVEFLIVIALILLNGFFAMSEMSLMTSRKSRLKQMAGSSKRAARALALAESPENFLSTVQ
IGITLIGILTGVFGGEAIGIAIGTWLQGIVPALDPYAPVIGKTLAVALITFLTLIFGELV
PKRLALRNSEDIAGVVAVPMAWLAKIAAPGVWVLARSTRLVLRMLGMGKDESASVSEEEI
RMLVAESHEAGVIDAHERDMMNRVMRLGDRTADSLMTPRNRIAWLDANAEPERNLHVMRE
HEFSRYPVYRGSDQDIAGVLEVKSLVTRMDGHGAQLFQNLRDTLFVSESTHAMKLLEIFR
EEQQSMALVVDEYGEIRGLVTISDLMGAVVGRLQSVENTDDDALVVTRADGSLLIDGSLP
VEELREVLGAELPEADEGDYHTLAGLCIYYFGRIPQAGEFFDWAGWRIEIVDLDGARVDK
LLLRRVGDEDSDDIVG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggttgagttcctgatcgtcatcgccctgattctgttgaacggcttcttcgccatgtcg
gagatgtcgctgatgacgtctcgcaagagccgcctgaagcagatggcaggctcgagcaag
cgcgccgcgcgggcgctggccctggccgagagcccggaaaacttcctgtccacggtccag
atcggcatcaccctgatcggcatcctgaccggcgtgttcggcggcgaggcgatcggcatc
gccatcggcacctggctgcagggcatcgtgccggcgctggacccgtacgcgccggtgatc
ggcaagaccctggcggtggcgctgatcaccttcctgacgctgatcttcggcgagctggtg
cccaagcgcctggccctgcgcaattccgaagacattgccggcgtggtggccgtgccgatg
gcctggctggcgaagatcgccgcgcccggcgtgtgggtgctggcgcgctccacccggctg
gtgctgcgcatgttgggcatgggcaaggacgaatcggcgtctgtcagcgaagaagagatc
cgcatgctggtggccgaaagccacgaagccggcgtgatcgacgcgcacgagcgcgacatg
atgaaccgggtgatgcgcctgggcgaccgcaccgccgacagcctgatgacgccacgcaac
cgcatcgcctggctggatgccaacgccgaacccgaacgcaatctgcatgtgatgcgcgaa
cacgagttctcgcgctacccggtgtaccgcggcagcgaccaggacattgccggcgtgctg
gaagtcaaatcgctggtgacccgcatggatggccacggcgcgcagttgttccagaacctg
cgcgacaccttgttcgtctccgaatccacgcatgcgatgaagctgctggaaatcttccgc
gaagaacagcaatcgatggcgctggtggtagacgaatacggcgagattcgcgggctggtc
accatcagcgacctgatgggcgccgtggtcggccgcctgcagtcggtggaaaacaccgac
gacgatgcgctggtggtcacgcgcgcagacggctcgctgctgatcgatggctcgctgccg
gtggaagaactgcgcgaagtgctgggcgccgagctgccggaagccgatgagggcgattac
cacacgctcgcgggcctgtgcatctactacttcggccgcattccgcaggccggcgaattc
ttcgactgggccggctggcgcatcgagatcgtcgacctggacggtgcgcgcgtggacaaa
ctgctgttgcgccgcgttggcgacgaggacagcgatgacatcgtcgggtga

DBGET integrated database retrieval system