KEGG   Xanthomonas campestris pv. campestris 8004: XC_2547Help
Entry
XC_2547           CDS       T00247                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K06148  ATP-binding cassette, subfamily C, bacterial
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcb02000]
    XC_2547
Transporters [BR:xcb02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    XC_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N ABC_membrane RsgA_GTPase AAA_29 AAA_21 SbcCD_C AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: AAY49597
UniProt: A0A0H2XA52
Position
complement(3079437..3081074)
Genome map
AA seq 545 aa AA seqDB search
MRADRSRIALYVLLSLAAALAGSAVAVCLVPLVQPGQGLRVAGQVLVLPGGLPLQASLFV
LVSLLFAVLRWQSARLAARLTSRYAIGLRQRVHASLLEAPLPALADASSAEIANVLTYNI
EIATQGFSAVLQLLVAGITAVVSVCLALLIVPGLAAAAPVLLVLAWCGLRASGSAQQARI
SRDYVADMTRLFWLSEDFPRRLRHVRSFQREDVETGHYTRISDRLGQGYAQQQALVANSR
LLLELTAVAAIAGILVVANLWQGADRAALITVSLLLGRLLPYLVSTRQSVQQLRSAWPAL
QLWRRYVALAAPRSESTRADASTLPAPLQIDRVTLLQPLSALQIPPLALVPGQITLVVGP
SGIGKSSLMDVLSGQTAPLHLQARMAGRMLGFPEYRALIRHSAYVGQGVRPWQRCVRDCL
KWALPGALEADMWAALADVGLGARLQRDPLGLDAPINGSDGRLSGGELQRLLLAQVLLRA
PALALLDEATSALDAQSEQQVLCMLRQRLPQTALVVVSHRTSLASIADHTVPLGAAATTP
AEAVP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgccgatcgcagccgcattgcgctctacgtgctgctgtcgctcgccgccgctttg
gcgggcagcgcggtggccgtgtgcctggtgccgctggtgcagcccggccagggcctgcgc
gtggccgggcaggtactggtcctgcccggcggcctgccattgcaggcaagcctgttcgtc
ctggtgagcctgctgtttgccgtgttgcgctggcagagcgcgcggttggcggcccgcttg
accagccgctatgccattggcctgcgccagcgcgtgcatgcctccttgctcgaggcgcca
ttgccggccttggccgatgccagctcggcggaaatcgccaacgtgctgacctacaacatc
gagatcgccacgcaggggttcagtgcggtgctgcagttgctggtggccggcatcaccgca
gtggtgagtgtgtgtctggcgctgttgatcgtgccgggtctggctgccgccgcgccggtg
ttgctggtgctggcctggtgcgggctgcgggcttcgggcagtgcgcagcaggcccgtatc
agtcgcgactacgtggccgacatgacccggctgttctggctgagcgaggacttcccgcgg
cggctgcgccacgtgcgctcgttccagcgcgaggatgtcgaaaccggccactacacgcgc
atttccgatcgcctggggcagggctacgcgcagcagcaggcactggtggccaacagccgc
ctgctgctggagctcaccgcagtggccgccatcgccggcattctggtggtggccaacctg
tggcagggcgccgatcgcgccgcgttgatcaccgtcagcctgttgctgggccgcctgctg
ccgtatctggtgtccacccggcaaagcgtgcagcagttgcgttcggcgtggccggccttg
caactgtggcgccgctatgtggcgcttgccgccccgcgcagtgaatccacacgtgctgat
gcttcgacattgccggcgccgctgcagattgatcgcgtcacgctgctgcagccactgtcc
gcgctgcagattccccccctggcgctggtgcccgggcagatcaccctggtggtggggcca
tcgggcatcggcaagagcagcctgatggatgtgctgtcgggccagaccgcgccgttgcac
ctgcaggcacgcatggcgggccgcatgctcgggtttcccgagtaccgcgcactgatccgc
cacagcgcctatgtggggcagggcgtacggccatggcagcgatgcgtgcgcgattgcctg
aagtgggcgctgcccggcgcgttggaggcagacatgtgggcggcgcttgccgatgtcggc
ctgggtgcgcggctgcagcgcgatccgctcgggctggatgcgccgatcaatggcagcgat
ggccggctctccggcggtgaactgcaacggctgttgctggcacaagtgttgttgcgcgcc
ccagcgctggccttgctggacgaagcgaccagcgcactggatgcgcagtctgagcaacag
gtgctgtgcatgttgcgccagcggttaccgcagaccgcgctggtggtggtctcgcatcgc
accagcttggccagcatcgctgaccacacagtgcccctgggtgctgcggcgactaccccc
gcggaagccgtgccgtag

DBGET integrated database retrieval system