KEGG   Xanthomonas campestris pv. campestris 8004: XC_2548Help
Entry
XC_2548           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpr_kinase_C AAA_29 ATPase AAA_25 ABC_tran RsgA_GTPase PEPCK_ATP AAA_16
Motif
Other DBs
NCBI-ProteinID: AAY49598
UniProt: A0A0H2X897
Position
complement(3081177..3082220)
Genome map
AA seq 347 aa AA seqDB search
MRAERAHAAMPAPLDPFDEQGPRRHGVRKQVLGASFHFESDSPALLSLVEAAYAGLPAHR
FDGAPQFHITLDVVARAPRLPVAEPPPVRTHAAAGLLCGVMDECNYLMVSVAERRAMVVV
SDDMLMHAYHLRYELIEFAVFLLAARGMSLVPLHGACVGWQGHGALLLGASGAGKSTLAL
HSLLRGLQFVAEDGVFVEPHSLVATGVANFLHLRPASLGLLDAPTRAWISAAPPSGGAAG
WKSSEVDLRDSRAVLAPAPLPLAAVVLLSDVPATDPAHLLTPMAHEEIAACLAADQPYAA
GQPGWSHFIAQVQQRGVYRMQRGAHPDAAVDALLQLLHRAASSLPGA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggcggagcgcgcgcacgctgcaatgccggccccgctggatccgtttgacgagcaa
gggccacgccggcatggcgtgcgcaagcaggtacttggcgcgtcgttccacttcgaaagc
gacagcccggcgctgctttcgctggttgaggccgcgtacgccgggctgcctgcgcatcgc
ttcgatggcgccccgcagttccatatcaccctggatgtggtggcgcgtgcgccgcggctg
ccggtggccgagccgccgccggttcgcacgcatgccgctgccggtctgctgtgcggggtg
atggacgaatgcaactacctgatggtgtcggtcgccgagcggcgcgccatggtggtggtg
tcggacgacatgctgatgcatgcctatcacctgcgctacgagttgatcgaattcgcggtg
ttcctgttggcagcgcgtggcatgtcgctggtgccgctgcacggcgcctgcgttggctgg
cagggacatggtgcgctcttgctcggggccagtggcgccggcaagtcgaccctggccttg
cacagcctgttgcgtgggctgcagttcgtggcagaagacggtgtctttgtggagccgcac
agcctggtcgcaaccggtgtagccaatttcctgcacctgcggccggcatcactgggcctg
ctggacgcacccacccgcgcctggatcagtgcggccccaccatccggcggcgcagcgggg
tggaaaagttctgaggtcgatctgcgcgatagccgcgcggtgctcgcgccggccccgctg
ccgttggcggcggtggtgttgctgagcgatgtgccggccaccgatccggcccacctgctg
acgccaatggcgcacgaggagatcgctgcatgcctggcggcggatcagccatatgcagct
ggccagcccggctggtcgcatttcatcgcgcaggtgcagcagcgtggcgtataccgcatg
caacgcggcgcgcatccggatgccgcagtggatgcgctgctgcagctgctgcaccgcgcc
gcatcctcactgccgggcgcgtga

DBGET integrated database retrieval system