KEGG   Xanthomonas campestris pv. campestris 8004: XC_2549Help
Entry
XC_2549           CDS       T00247                                 

Definition
(GenBank) Mg-protoporphyrin IX monomethyl ester oxidative cyclase
  KO
K04034  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC:1.21.98.3]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00860  Porphyrin and chlorophyll metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XC_2549
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.98  With other, known, physiological acceptors
    1.21.98.3  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase
     XC_2549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM B12-binding
Motif
Other DBs
NCBI-ProteinID: AAY49599
UniProt: A0A0H2X8K5
Position
3082257..3083969
Genome map
AA seq 570 aa AA seqDB search
MRHAVSSVHKFSRCVRLGRRKVACIARRAHERRAAHGSCIGTTKVACMRTYCRAECRCLA
RAAAAPTWRQNENLAQMLKIQVSHSYFLRYDPKQWERGKPYPPLATLQVAALLREHGHRL
SLFDAMLADDVQDYPGALQAAQPDLVVFYEDNFNFLTKMCLSRMREAACTMIATARAQGC
RVLVAGSDASDNPDVFLAAGADAVLIDEGIAPLLELVARLDANPQCAPDTWLDGVARIAT
AHPAAAREHVGAQPPDARLGGLPAWDLVDIPRYRTFWQQRHGYFSLNMAASRGCPFRCNW
CAKPIWGNHYKRRSAEDVAAEMIHLKRTFGPDHIWMADDIFGFHIDWVETFAEQLSDADG
AIPFMIQTRADLASDRMATALARAGCAEAWLGAESGSQRILDKMTKGTQVADVIAARRRL
GARGIRVGFFIQLGYLGEELVDILATRALVREAAPDLIGVSVSYPLPGTKFYEEVKNQLG
GKTHWQDSDDLAMMFRGAYDSEFYRSVRNLLHTEVDLQQARTTMGDLAYAQAWQALEQRW
DSLIASEHAHRTEPLTAARPVRQLASVLVG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
ttgcggcatgccgtttcatccgtgcacaagttcagccggtgtgtgcggctcggccgccga
aaggttgcgtgcattgcccgccgcgcgcatgaacggcgcgcagcgcacggctcgtgcatc
ggcacaaccaaagtggcttgcatgcgcacctactgccgagccgaatgccggtgtcttgcg
cgcgccgctgctgcgcccacctggcgacagaacgagaaccttgcgcagatgctaaagatc
caggtcagccattcgtacttcctgcgttacgaccccaaacaatgggaacgcggcaagccc
tatccgccgcttgccacgttgcaggtggccgccttgctgcgcgaacacggccatcgtttg
agcctgttcgatgccatgcttgccgacgacgtgcaggactaccccggcgcgctgcaggcg
gcgcagccggacctggtggtgttctacgaagacaacttcaacttcctcaccaagatgtgc
ctgagccgcatgcgcgaggcggcctgcacgatgatcgccaccgcgcgcgcgcagggctgc
cgcgtgctggtggccggctccgatgcctccgacaacccggatgtgtttctggccgccggt
gccgatgcagtgttgatcgacgaaggtatcgcgccgttgctggaactggtggcgcggttg
gacgcgaacccgcaatgcgcacccgacacctggctggacggcgtggcacgcatcgccacc
gcgcatcctgccgccgctcgcgaacacgtgggcgcgcagccgccggatgcgcggctgggc
ggattgcccgcgtgggatctggtggacatcccgcgctatcgcaccttctggcaacaacgc
cacggctatttcagcctcaacatggccgcctcgcgcggctgcccgttccgctgcaactgg
tgcgccaagccgatctggggcaaccactacaagcgccgcagcgcagaagacgtggccgca
gagatgatccacctcaagcgcacatttgggcccgatcacatctggatggccgatgacatc
ttcggcttccatatcgactgggtggaaaccttcgccgagcagctcagcgatgccgatggt
gcgatccccttcatgatccagacgcgcgccgatcttgccagcgaccgcatggctaccgcc
ctggcgcgtgccggttgcgccgaggcgtggctgggcgcggaaagcgggagccagcgcatc
ctagacaagatgaccaagggcacgcaggtggccgatgtcatcgccgcacgccgccgcctg
ggtgcgcgcgggatccgcgtgggcttcttcatccagctgggctatctgggcgaagaactc
gtcgacatcctggccacccgcgccttggtgcgcgaggccgcaccggatctcatcggtgtc
agcgtgtcgtatccgctgcccggcaccaagttctacgaggaagtgaaaaaccagctgggt
ggcaagacgcattggcaggacagcgacgacctggcaatgatgttccgcggtgcctacgac
tcggagttctaccgcagcgtgcgcaacctgctgcacaccgaagtggacctgcagcaggcg
cgcaccacgatgggcgatctggcgtatgcgcaggcgtggcaagcgctggagcagcgctgg
gacagcttgatcgcctccgagcacgcgcatcgcaccgaaccgttgacggcggcgcgacca
gtgcgccagctggccagcgtgctggtcggctga

DBGET integrated database retrieval system