KEGG   Xanthomonas campestris pv. campestris 8004: XC_2927Help
Entry
XC_2927           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06193  protein PhnA
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    XC_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnA PhnA_Zn_Ribbon OrfB_Zn_ribbon UPF0547 DUF4379 MoeA_C
Motif
Other DBs
NCBI-ProteinID: AAY49975
UniProt: A0A0H2XB41
Position
complement(3513404..3513739)
Genome map
AA seq 111 aa AA seqDB search
MSTAPACPQCSLDNTYADGALWICADCGFEWSAAEAPANAVVVRDSNGNVLDAGDTVTVI
KDLKVKGSSIPLKQGTVIRNIRLVEDDAEHIEGNSDKIKGLVLKTCFLRKA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgcgcccgcctgtccgcaatgcagtctggacaacacctatgccgatggcgcg
ctgtggatctgcgccgattgcggtttcgagtggagcgccgccgaggcgccggctaacgcg
gtggtcgtgcgcgacagcaacggcaatgtgctcgacgccggcgacaccgtcacggtgatc
aaggacctcaaggtcaagggctcgtcgattccgctcaagcagggcacggtgatccgcaat
attcgcctggtcgaggacgatgccgagcacatcgaaggcaactccgacaagatcaagggc
ctggtgctgaagacctgcttcctgcgcaaggcctga

DBGET integrated database retrieval system