KEGG   Xanthomonas campestris pv. campestris 8004: XC_2929Help
Entry
XC_2929           CDS       T00247                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
Enzymes [BR:xcb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     XC_2929
Chaperones and folding catalysts [BR:xcb03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    XC_2929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AAY49977
UniProt: A0A0H2XB30
Position
3514978..3515451
Genome map
AA seq 157 aa AA seqDB search
MEITQGRVATIHYTLSDDSGQVLDRSTPDTPLSYLHGAGNIVPGLEQALDGKRTGDTLTA
DVAPEQGYGPRHAQLIQHVPREAFPSDVDVVPGAQFEARTQQGPVMVTVTEVGPEQVTVD
GNHPLAGQTLHFAVEVTAVREATTEELDQGHVTDIAA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcacccagggtcgcgttgcgaccattcactacaccctctccgacgacagcggc
caggtgctcgatcgctccacgcccgacaccccgctgagctatctgcacggcgccggcaac
atcgtgccgggcctggaacaggcactggacggcaagcgcaccggcgacacactcaccgcc
gatgtcgcgccggaacagggctacggcccgcgccatgcgcaattgatccagcacgtgccg
cgcgaagctttccccagcgacgtggacgtggttccgggcgcgcagttcgaagcgcgcacc
cagcaggggccggtgatggtcactgtcaccgaggtcggccccgagcaggtcaccgtggac
ggcaatcacccgctggccgggcaaaccctgcatttcgccgtcgaagtgaccgcggtgcgc
gaggccaccaccgaagaactcgaccagggccacgtcaccgacatcgccgcctga

DBGET integrated database retrieval system