KEGG   Xanthomonas campestris pv. campestris 8004: XC_2941Help
Entry
XC_2941           CDS       T00247                                 

Definition
(GenBank) leucine dehydrogenase
  KO
K00263  leucine dehydrogenase [EC:1.4.1.9]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00280  Valine, leucine and isoleucine degradation
xcb00290  Valine, leucine and isoleucine biosynthesis
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XC_2941
   00290 Valine, leucine and isoleucine biosynthesis
    XC_2941
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.9  leucine dehydrogenase
     XC_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C NAD_binding_2 AdoHcyase_NAD TrkA_N AlaDh_PNT_C adh_short_C2 F420_oxidored adh_short
Motif
Other DBs
NCBI-ProteinID: AAY49989
UniProt: A0A0H2X987
Position
3523277..3524377
Genome map
AA seq 366 aa AA seqDB search
MLFETLDTTGHEQVIFCHNRDAGLKAIIALHSTRLGPALGGVRMRPYANSEAALNDALRL
SRTMTYKNALAGLNVGGGKAVIIGDPKTDKSEALFRAFGRFVDTLGGRYITSEDVGTDVN
DMEQIYLESEYVTGVHQVHRGSGDPAPFTAYGALQALMASLNRKLGHEEVGKASIAIQGL
GHIGMELVKLLKERGAKLYVADLNPALVDRAVSEYGAEAVRPEEIHEVPADVFAPCALEG
AINEDTLPRLKAKIICGTANNQLSSAAIGEELHKRGILYAPDYVVNAGGVMNVSLEIDGY
NRERAMRLIRSIYHNLEKVFDLSTQLGIPPQQAADQIAETRIEAISKLKLPLGRTAPRFL
HKLRGE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcgaaaccctcgataccaccggccatgagcaggtgattttctgccacaaccgc
gacgccggcctcaaggccatcatcgcgttgcacagcacccgtctggggccggcactgggt
ggggtgcgcatgcggccgtatgccaacagcgaagccgcgctcaacgacgcgctacggctc
agccgcaccatgacctacaagaacgcgctggccggcctcaatgtcggtggcggcaaggcc
gtgatcatcggcgacccgaagaccgacaagagcgaggcgctattccgcgcctttggccgc
tttgtcgacaccctgggaggccgctacatcacctccgaggatgtgggtaccgatgtcaac
gacatggagcagatctacctggagagcgagtacgtcaccggcgtgcatcaggtgcatcgc
ggctccggcgatcccgctccgttcaccgcctacggcgcgctgcaggcgctgatggcctcg
ctcaatcgcaagctcggccatgaagaagtgggcaaggccagcatcgcgatccagggcctg
ggccatatcggcatggaactggtgaagttgctcaaggaacgcggcgccaagctctatgtg
gccgatctcaatccggcgctggtggatcgcgcagtgtccgaatacggcgccgaggccgtg
cgccccgaagagattcatgaagtgcccgccgatgtgtttgcgccctgcgcactcgaaggt
gccatcaacgaagacacgctgccgcggctcaaggccaagatcatctgcggcacggccaac
aatcagttgtccagcgcagcgatcggcgaagagctgcacaagcgcggcattctgtatgcg
cccgactatgtggtgaatgccggcggcgtcatgaatgtgtcgctggagatcgacggctac
aaccgcgaacgtgcgatgcgcctgatccgcagcatctaccacaacctggaaaaggtgttc
gacctgtccacccagctcggcatcccgccgcagcaggcggccgaccagattgccgaaacg
cggatcgaagcgatcagcaagctcaagctgccgctgggccgcaccgcaccgcgcttcctg
cacaagttgcgcggcgagtaa

DBGET integrated database retrieval system