KEGG   Xanthomonas campestris pv. campestris 8004: XC_2945Help
Entry
XC_2945           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1510
Motif
Other DBs
NCBI-ProteinID: AAY49993
UniProt: A0A0H2XB46
Position
3529389..3529724
Genome map
AA seq 111 aa AA seqDB search
MNKIRMLSLSAVAVAVVTLAACQGPDAEQARRDAASAAKHAAAATEQAADRAAVQAKEAT
ADARVAARDLAADASRATANAADATADKTREMANKAEQNAAEKNAEHDAQH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatccgcatgctgtcgctgagcgccgttgctgttgctgtggtaaccctcgcc
gcctgccagggcccggatgccgaacaggcacgccgcgatgccgcctctgccgcaaagcac
gctgccgccgcgaccgagcaggccgccgaccgcgctgccgtgcaggccaaggaagccact
gccgatgcacgcgtcgccgcacgcgacctggccgccgacgccagccgcgctaccgccaac
gccgccgatgccactgccgacaagacccgcgagatggccaacaaggccgagcagaatgcg
gccgaaaagaatgccgagcacgacgcgcagcattga

DBGET integrated database retrieval system