KEGG   Xanthomonas campestris pv. campestris 8004: XC_2946Help
Entry
XC_2946           CDS       T00247                                 

Definition
(GenBank) sensor histidine kinase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF CHASE3 GAF_2 GAF_3
Motif
Other DBs
NCBI-ProteinID: AAY49994
UniProt: A0A0H2X991
Position
3529868..3531604
Genome map
AA seq 578 aa AA seqDB search
MPSSFTSRRRNQLALVFSALIFIAIGIGIFIGARRSLADAALVSHTHEVIGRVDEIQARV
LDAESAERGYLLTGNDAYLLDYQTSVERLPILIGNLRRKIADNPSQVAHLDQLHHLVDTR
LKQIQHVLDVYADSGLEPARTSIRQTAFRTTSVIREQALTMVQREQELLALRAESSRQSA
LLLLILALAGIPLGLAVVGTVYGLLMRELRHRAQAERHAARANQELGESIGALQRSAADL
NLLSRYTGLLQSCVSAEEALDVTSRTLAHLLPGIAGSVYLLRASQDRAEVISHWGTPLVH
SASHLLPEECWALRRGQPHLIEDLARDAPCAHIDLPDASVAITTACLPMSAQGTQLGFLF
LSAPGPAPMPRLEIAEAAAEQLSLALSNLRLRESLRRQSIRDALTGLYNRRYLEEALSHE
LARCARRDLPLSVLMLDVDHFKQFNDGQGHAGGDLLLAAVGELLLTRLRAEDVACRYGGE
EFTVILPETDGEEAMRVAEQIRGHIAALAVSDGQRALPRVTASIGVASFPADGELGSALI
QKADAALYVAKRQGRNRVERHGAVAVNAEPVGTNGAIV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcctttacctcgcggcgccgcaatcagctggcgctggtcttctctgcgctc
atctttattgcgatcgggatcggcatcttcatcggtgcgcgccgctccctcgccgatgcc
gcgctcgtctcgcatacgcatgaagtcattggccgcgtcgatgagatccaggcgcgcgtg
ctcgatgccgaatcggccgagcgcggctacctgctcaccggcaatgacgcgtacctgctg
gactatcagaccagcgtggagcggctgccgatcctgatcggcaacttgcgccgcaagatc
gccgacaacccttcgcaggtggcgcatctggatcaactgcatcatctggtcgacacgcgg
ctcaaacagattcagcacgtgctcgacgtctacgccgacagcggcctggagccggcgcgt
acaagcattcgccagaccgcgtttcgcaccaccagcgtcatccgcgaacaggcactgacc
atggtgcagcgcgagcaggagctgctggcattgcgtgcggaaagcagccgccaaagtgcg
ttgttgttgctgatcctggcgctggccggcatcccgttagggctggccgtggtcggcacg
gtgtacggcctgctgatgcgcgaactgcggcatcgcgcgcaggccgagcggcatgccgca
cgtgccaaccaggaactgggcgagagcatcggcgccctgcagcgcagcgcggccgatctc
aatttgctcagccgctacaccggcctgctgcagagttgcgtcagtgccgaagaagcactg
gatgtcaccagccgcacgctcgcgcatttgctgcccggcattgccggcagcgtgtatctg
ctgcgcgcctcgcaggaccgcgccgaggtgatcagccactggggcacgccgttggtgcac
agcgcctcgcacctgctgcccgaagagtgctgggcactgcgccgcggccagccccacctg
atcgaagacctggcgcgcgatgcgccgtgcgcgcacatcgacctgcccgatgcgagcgtg
gcaatcaccaccgcgtgcctgccgatgtcggcacagggcacgcagctgggttttctgttc
ctgtccgcgcccggcccggcgccgatgccccgcctggagatcgctgaagcggccgccgag
cagttgtcgctggccttgagcaatttgcgtctgcgcgaatcgctgcgccgtcagtccatc
cgcgatgcgctgacggggttgtacaaccgccgttacctggaagaagcgctcagccatgaa
ctggcgcgctgcgcacgccgtgatctgccgctgtcggtactgatgctggatgtggaccac
ttcaagcagttcaacgacggccagggccatgccggcggcgatctattgctggccgcagtc
ggtgaattgctgctcacccgcctgcgcgccgaagacgtggcctgccgctacggtggcgag
gaattcaccgtgatcctgccggaaaccgacggcgaggaagcgatgcgcgtggccgaacag
atccgcggccacattgctgcgctggcggtcagcgacggccagcgcgcgctgccacgggtc
accgcgtcgatcggcgtggccagcttcccggccgatggcgagctgggatcggccttgatc
cagaaggccgatgccgcgctgtacgtggccaagcgccagggccgcaaccgggtggaacgg
cacggggcggtggcggtgaatgccgaaccggttggcacaaacggcgcaattgtttga

DBGET integrated database retrieval system