KEGG   Xanthomonas campestris pv. campestris 8004: XC_2950Help
Entry
XC_2950           CDS       T00247                                 

Definition
(GenBank) hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY49998
UniProt: A0A0H2XB51
Position
3534046..3534279
Genome map
AA seq 77 aa AA seqDB search
MNPLPARRYVRARPRIRLSGALAFRRHALAFCVHRATPAATLGPPRPQRRPRALSAFTRA
ALRLRAKPLLASAETTP
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgttgcctgcacgccgctatgtccgcgcgcggccgcggatccggctgagtggc
gcactggcgtttcgccggcatgcgctggccttctgcgtgcatcgcgccacccccgccgcc
acgctggggccaccgcgcccgcaacggcgcccacgtgcgttgagtgcattcacccgcgct
gccttgcgtctgcgcgcgaaaccgctgctggccagcgcggaaacaacgccgtga

DBGET integrated database retrieval system