KEGG   Xanthomonas campestris pv. campestris 8004: XC_2954Help
Entry
XC_2954           CDS       T00247                                 

Definition
(GenBank) oxidoreductase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 NAD_binding_8 NAD_Gly3P_dh_N RsdA_SigD_bd
Motif
Other DBs
NCBI-ProteinID: AAY50002
UniProt: A0A0H2X9J8
Position
complement(3539099..3540370)
Genome map
AA seq 423 aa AA seqDB search
MQQTLRIAVVGYGTAGQALAVLLGADGHRLDVFERAPAPGPVGAGFLLQPSGLQVLWKMG
LLEQALQHGAPVRRLYGETPCGRAVMDMRYRDLDARLMGLGMQRGALFALLRDAWPEYAN
LHIGTQITAIDHDGVRVQDQRGQWHGPYDLIIAADGSASTLRAQAQGTQLDRVYPWGALW
CLLPREDWPYVDELRQRYIGARKMIGLLPVGTRPGDDTPRLSFFWSLPCSDFAAWETRGM
DAWREEVAQMWPDALARLQTVQVHGALARASYRDAVVSRWHRGRFALAGDAAHAMSPQLG
QGVNMALLDALAMRDALRAGADLDAALQGYQRERQAHVAIYHRWSRWLTPLFQSERDVWA
RGRDLLLQPMGRVPGGRGHMLRVLSGTQHGWFGKLALDPAFVDALAQPVPVPSSSNAGDG
MAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagacattgcgaattgcggtagtgggatacggcacggcggggcaggcactggcc
gtgctgctcggtgccgatgggcatcgcctggacgtgttcgagcgcgcgcccgcgcccggg
ccggttggtgcgggatttctgttgcagccgagcgggctgcaggtgctgtggaagatgggg
ctgctggagcaggccttgcagcacggtgcaccggtgcggcggttgtatggcgagacgccc
tgcgggcgcgcggtgatggacatgcgctaccgcgacctggatgcgcgcctgatgggcctg
ggcatgcagcgcggcgcgttgttcgcgttgctgcgcgatgcctggcccgagtacgccaac
ctgcacatcggcacgcagatcactgcgatcgatcatgacggcgtgcgtgtgcaggaccag
cgcgggcaatggcatggcccctacgatctgatcatcgccgccgatggctcggcatcgacc
ttgcgcgcgcaggcccagggcacccagctggatcgggtgtatccatggggcgcgctgtgg
tgtttgttgccacgcgaagactggccgtacgtggacgagttgcggcagcgctacatcggc
gcacgcaagatgatcgggctgctgccggtgggcacgcggccgggcgatgacacgccgcgg
ctaagctttttctggagcctgccctgcagcgatttcgctgcatgggaaacccgcggcatg
gacgcctggcgcgaagaagtggcgcagatgtggccggacgcgcttgcgcgcctgcagacc
gtgcaggtgcatggcgccttggcgcgcgccagctaccgcgacgcggtggtgtcgcgctgg
caccgcggccgctttgcgctggccggcgacgccgcgcacgcgatgagcccgcagctgggg
cagggcgtgaacatggcgctgctggatgcactggcgatgcgcgatgccttgcgcgccggc
gcggatctggatgccgcattgcagggctaccaacgcgaacgccaggcgcatgtggcgatc
tatcaccgctggagtcgctggctcacgccgcttttccagtccgagcgcgatgtgtgggcg
cgcggacgcgatctgttgctgcagccgatgggccgcgtgccgggtgggcgcggccacatg
ctgcgcgtgctcagcggcacccagcacggctggttcggcaagctcgcgctggacccggcg
ttcgtcgatgcattggcgcaaccggtgccggtgccaagttcgagtaatgcaggagatggc
atggctgcgtag

DBGET integrated database retrieval system