KEGG   Xanthomonas campestris pv. campestris 8004: XC_2955Help
Entry
XC_2955           CDS       T00247                                 

Definition
(GenBank) cold shock protein
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xcb03000]
    XC_2955
Transcription factors [BR:xcb03000]
 Prokaryotic Type
  Other transcription factors
   Others
    XC_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AAY50003
UniProt: A0A0H2XB58
Position
complement(3540467..3540673)
Genome map
AA seq 68 aa AA seqDB search
MPNGTVKWFNDAKGFGFISPEDGSADVFAHFSAINSKGFRSLQEGQRVSYDVTQGPKGAQ
ASNITPVE
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacggtaccgtcaagtggttcaacgacgccaagggatttggcttcatctcaccg
gaagacggcagcgccgatgtcttcgcgcacttctccgcgatcaactccaagggcttccgc
agcctgcaggaaggccagcgcgtcagttatgacgtgacccagggccccaagggtgcccag
gcttcgaacatcacgccggttgagtga

DBGET integrated database retrieval system