KEGG   Xanthomonas campestris pv. campestris 8004: XC_2961Help
Entry
XC_2961           CDS       T00247                                 

Definition
(GenBank) polyketide synthase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_3
Motif
Other DBs
NCBI-ProteinID: AAY50009
UniProt: A0A0H2XB62
Position
complement(3546354..3547055)
Genome map
AA seq 233 aa AA seqDB search
MHTPVMRIDIWSDVVCPWCWIGKRRFEQAVATLGERLPALEIHYHAFQLDPDSGLQPVPL
REALLPKFGSAERTEQLLAQTQQTARAEGLPFDFSRGQVQVTTLPAHRLIWLAAREGDVE
PVIEALFHAHFAEGKNLAAADTLIAAGAAGGLAPARVQALLASDEGSAQVQAQLLQAAQI
GIRAVPSFVIDGRSLLQGAQPADVMAQALLQLAAESAPAAATGDACGPDGCAI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgcacacacctgtcatgagaatcgatatctggtccgatgtggtgtgcccgtggtgctgg
atcggcaaacgccgcttcgagcaggccgtggccacgcttggggagcgcttgccggcgctg
gaaatccactaccacgccttccagctggatccagacagtggcctgcagccggtgcccttg
cgcgaggccttgctgccgaagttcggcagcgccgaacgtaccgaacaattgctggcgcag
acccagcaaaccgcgcgcgccgaaggcctgccgtttgatttttcgcgtgggcaggtacag
gtcaccaccttgcccgcgcaccggctgatctggttggcggcgcgcgagggtgatgtcgag
ccggtgatcgaagcgctgttccatgcgcactttgccgaaggcaagaatcttgcggcggcc
gacaccctgatcgctgccggtgcggctggcgggttggcgccggcacgcgtgcaggcgctg
ctggcgtccgacgagggcagtgcgcaggtccaggcgcaactgctgcaggccgcgcagatt
ggtatccgcgcggtacccagtttcgtcatcgacggacgcagcctgcttcagggtgcgcaa
ccggccgatgtcatggcacaggcgttgctgcaattggccgccgaatccgcgccggccgcc
gctaccggcgatgcctgcggcccggacggttgcgcgatctga

DBGET integrated database retrieval system