KEGG   Xanthomonas campestris pv. campestris 8004: XC_2962Help
Entry
XC_2962           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XC_2962
Enzymes [BR:xcb01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     XC_2962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH
Motif
Other DBs
NCBI-ProteinID: AAY50010
UniProt: A0A0H2X9A7
Position
complement(3547132..3547626)
Genome map
AA seq 164 aa AA seqDB search
MGIEIERKFLVTGDGWRTATHAVIPMAQGYINDQASLRSGAQNASVRVRLQGDAAFLNLK
SRELGHTRQEFEYPIPLDDARALLALCVGGLIDKRRHLVEYAGHVWEVDEFLGDNAGLVV
AEVELEHADEALQLPDWIGAEVTDDARYYNLALASQPFSQWSVR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgaaatcgaacgcaaatttctggtgaccggcgacggctggcgtaccgccacg
catgcggtcattccgatggcgcagggctatatcaacgaccaggcgtcgctgcgcagtggt
gcgcagaatgcctcggtgcgtgtgcgcctccagggcgatgcggcattcctcaacctcaag
tcgcgcgagctcgggcatacccgtcaggagttcgaatatccgattccgctcgacgatgcg
cgcgcgttgctcgcgttgtgtgtgggtgggctgatcgacaagcgccggcatctggttgag
tacgccgggcatgtgtgggaagtggacgaattcctgggtgacaacgccgggctggtggtg
gcggaggtcgagctggagcacgccgacgaagcgctgcaactgccagactggatcggcgca
gaagtcaccgacgatgcgcgttactacaacctggcgttggcatcgcagccattttcgcag
tggtcggtacgctga

DBGET integrated database retrieval system