KEGG   Xanthomonas campestris pv. campestris 8004: XC_2963Help
Entry
XC_2963           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY50011
UniProt: A0A0H2X9P5
Position
3547657..3548361
Genome map
AA seq 234 aa AA seqDB search
MPGYCGSHPPTLRAPTERMHAMTGRRRYTPQIVLATALLLAASGASAAAAAPSLAQAQAA
LDTAMQKDAAGNPNQGDDVMGELFRPRLTALVGCLPAAEQTTPGAVDCLVTGQAGPSEKH
MALRFLPTANGWQLQHSDTEMEVAAPVPDNARVQVLLREDFSKKLVTERNEAVRKSLEQA
VSTAQVLAVERCAVSEHAPVVACTVQASAANERGELPMQFALVDGQWQNATPAH
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcctggctattgtgggagccacccacctacactccgcgcccccactgaaaggatgcac
gccatgacaggccgtcgccgttacacaccgcagatcgttcttgccaccgcactgctgctc
gccgccagcggtgcaagcgccgcggccgcagcgccctcgctcgcacaggcccaagccgcg
ctggacacagcgatgcagaaggacgcggcaggcaaccccaaccagggcgatgacgtgatg
ggtgagctgtttcgcccacgtttgacggctctagttggctgcctgcccgccgcggagcag
acgaccccaggcgcagtcgattgcctcgtcaccggacaggccggacccagcgaaaagcac
atggcactgcgattcctgccaaccgccaacggctggcagttgcagcacagcgacaccgag
atggaagtcgccgcaccggtgcccgacaacgcgcgcgtgcaggtgctgctacgggaagat
ttttccaagaagctggtgaccgaacgcaatgaagctgtgcgcaagagtctcgaacaggcg
gtcagcacggcgcaggtccttgcggtggagcgctgcgccgtctccgagcacgcaccggtg
gttgcctgcactgtccaggccagtgctgccaacgagcgcggcgaattgccgatgcagttc
gccctggtcgatgggcagtggcagaacgccacccccgcacactga

DBGET integrated database retrieval system