KEGG   Xanthomonas campestris pv. campestris 8004: XC_2965Help
Entry
XC_2965           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg FleQ Hpt HrpB1_HrpK
Motif
Other DBs
NCBI-ProteinID: AAY50013
UniProt: A0A0H2XB65
Position
3550028..3550750
Genome map
AA seq 240 aa AA seqDB search
MNMATRQEPQPRVLLVEDDPISRGFLQAVLESLPAQVDWADSLSSALDRARARRHDLWLI
DVNLPDGTGSDLLRALRLLHPDVPALAHTADGNAAMQRGLQSDGFLEMLVKPLTSERLLQ
AVRRGLARGRYSVAPVGVVDIAASDWDEAAALSALNGQQHHLNALRELFLAELPGTRDAV
DSALLVSDELALRNHLHRLQASCGFVGAARLAGAVRLLRGDPQSRIAQNQFHAAVAALLH
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcaacacgtcaggaaccccagccgcgcgttctgttggtcgaggacgacccg
atcagccgtggctttctgcaggccgtgctcgaaagcctgcccgcccaggtcgactgggcc
gactccctgtcttcggcactggaccgcgcgcgcgcgcgccggcatgacctgtggctgatc
gacgtcaacctcccagacggcaccggcagcgacctgttgcgcgccctgcgcctgctgcac
ccggatgtccccgccctggcgcataccgccgacggcaacgcggccatgcaacgcggcctg
caatcagacggctttctggaaatgctggtcaagccgctgacctccgaacggctgctgcag
gcggtacgccggggcctggcacgtgggcgctacagcgtggccccggtgggcgtggtggat
atcgccgccagcgactgggacgaagccgccgcactgagtgcgctcaacggccagcagcat
cacctcaatgccttgcgcgaattgttcctggcagagctgcctggcacccgcgacgccgta
gattcggcgctgctggtcagcgacgagctggcgctgcgcaatcacttgcaccgtctgcag
gccagctgtgggtttgtcggtgccgcccggcttgctggcgcagtgcggttgctgcgtggc
gatccgcagtcgcgcattgcacagaaccagttccatgccgcagtggccgcgctgctgcac
tga

DBGET integrated database retrieval system