KEGG   Xanthomonas campestris pv. campestris 8004: XC_2969Help
Entry
XC_2969           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4845 N_methyl COMMD1_N Pox_A14
Motif
Other DBs
NCBI-ProteinID: AAY50017
UniProt: A0A0H2X9K7
Position
complement(3553334..3553741)
Genome map
AA seq 135 aa AA seqDB search
MHAVRAGGHTMKRKQSGMTLTSFVVVLAVVGFALYLGMKLFPMYQEYYAVRTSMKGLANE
AGSADMDPSKLQDMFFKRLDINSSESVKPGDVKFERIEGGWRMKVNYEVRRELVGNLDVV
GKFDTEQDLTRRGVE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggtgcgtgccgggggacacacaatgaagcgcaagcaaagcggtatgacgttg
acgtcgttcgtggtggtgctggcggtggtggggtttgcgttgtatctggggatgaagttg
ttcccgatgtatcaggaatattacgcagtccgtacgtcgatgaagggccttgcgaatgaa
gcgggcagtgccgacatggacccgtccaaattgcaggacatgttcttcaagcggctcgat
atcaactcctccgaaagcgtcaagccaggggacgtcaagttcgagcgcatcgaaggcggc
tggcggatgaaggtcaactacgaagtgcggcgtgagctggtcggcaatctcgatgttgtc
ggcaagttcgacaccgagcaggatctgacgaggcgtggtgtcgaatag

DBGET integrated database retrieval system