KEGG   Xanthomonas campestris pv. campestris 8004: XC_2970Help
Entry
XC_2970           CDS       T00247                                 

Definition
(GenBank) signal peptidase I
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02024  Quorum sensing
xcb03060  Protein export
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    XC_2970
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XC_2970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xcb01002]
    XC_2970
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     XC_2970
Peptidases [BR:xcb01002]
 Serine Peptidases
  Family S26: signal peptidase I family
   XC_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S24 Peptidase_S26
Motif
Other DBs
NCBI-ProteinID: AAY50018
UniProt: A0A0H2XB67
Position
complement(3553742..3554542)
Genome map
AA seq 266 aa AA seqDB search
MKWFEIALVVLTLGTGFIWLLDKLFLAKRRAARAGLLDSEPAIIDYSRAFFPVLAVVLIL
RSFVAEPYKIPSSSMMPNLLIGDFILVNKFAYGFRLPITNTKFIPTGEPKRGDVVVFKPP
HAPDQNWIKRVVGLPGDKIGFHGDTLYINDKPMRYTVKGEYIGKGKGAEMTGTTLLVEDL
PGRTHTVLEWVDRNMPAGQGDWTVPADSYFVMGDNRDNSEDSRFWTQTHFLPEANLRGKA
FLIWLNCEGWFCKGSFDPSRIGTGIQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggtttgaaatcgccctggttgtgttgacgctgggcaccggcttcatctggcta
ctggacaagctgttcctggccaagcgccgcgcggcgcgcgccggtctgctggacagcgag
ccggcgatcatcgactactcgcgtgcgttctttccggtgctggcggtggtgctgatcctg
cgcagcttcgtggccgagccgtacaagattccgtccagctcgatgatgcccaacctgctc
atcggtgatttcatcctggtcaacaagttcgcttacggcttccggttgccgatcaccaac
accaagttcatcccgaccggtgaacccaagcgcggcgacgtggtggtgttcaagccgccg
catgcgccggaccagaattggatcaagcgcgtggtcggcctgccgggcgacaagatcggc
ttccacggtgacacgctgtacatcaacgacaagccgatgcgctacaccgtcaagggcgag
tacatcggcaagggcaagggcgccgagatgaccggtaccacgctgctggtggaagacctg
cccgggcggacccacaccgtgctggagtgggtagaccgcaacatgccggctggccagggt
gactggacggtgccggcagacagctatttcgtgatgggggacaatcgcgacaatagcgag
gacagccgattctggacgcagacgcacttcctgccggaggccaatctccgcggcaaggcg
ttcctgatctggctcaattgtgaagggtggttctgcaaggggagtttcgatccatcgcgg
atcgggactggaatccagtaa

DBGET integrated database retrieval system