KEGG   Xanthomonas campestris pv. campestris 8004: XC_2971Help
Entry
XC_2971           CDS       T00247                                 

Definition
(GenBank) GTP binding protein
  KO
K03596  GTP-binding protein LepA
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LepA_C GTP_EFTU EFG_C GTP_EFTU_D2 RF3_C EFG_II MMR_HSR1 Ras MMR_HSR1_Xtn
Motif
Other DBs
NCBI-ProteinID: AAY50019
UniProt: Q4USF4
Position
complement(3554646..3556451)
Genome map
AA seq 601 aa AA seqDB search
MSSDSMRNIRNFSIIAHVDHGKSTLADRIIQLCGGLQAREMEAQVLDSNPIERERGITIK
AQSVSLPYTAKDGQTYFLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVAN
CYTAVEQGLEVVPVLNKIDLPTADIERAKAEIEAVIGIDAEDAVAVSAKTGLNIDLVLEA
IVHRIPPPKPRDTDKLQALIIDSWFDNYLGVVSLVRVMQGEIKPGSKIQVMSTGRTHLVD
KVGVFTPKRKELVALGAGEVGWINASIKDVHGAPVGDTLTLAADPAPHALPGFQEMQPRV
FAGLFPVDAEDYPDLREALDKLRLNDAALRFEPESSEAMGFGFRCGFLGMLHMEIVQERL
EREYNLNLISTAPTVVYEVLKTDGTIIPMDNPSKLPPLNHVEEIREPIIRANILTPPDYV
GNIITLCEEKRGSQIGINYLGSQVQISYELPMAEVVLDFFDKLKSVSRGYASLDYHFLRF
DAGPFVRVDTLINGDKVDALSIIVHRSYADRRGRELCEKMKELIPRQMFDVAIQAAVGSQ
IISRSTVKAMRKNVLAKCYGGDVSRKKKLLEKQKEGKKRMKQVGRVEIPQEAFLAVLQMD
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctgattcaatgcggaatatccgcaacttctccatcattgcccacgtcgaccac
gggaaatccaccctggccgaccggatcatccaactgtgcggcggtttgcaggcgcgcgag
atggaagcccaggtgctcgactccaacccgattgagcgcgaacgtggcatcacgatcaag
gcgcagtcggtgtccttgccgtacacggcaaaagacgggcagacctatttcctgaacttc
atcgacacccccgggcatgtggacttctcctatgaagtcagccgctcgctggcggcctgc
gaaggtgcattgctggtggtggatgcggcgcaaggcgtggaagcgcagtcggtcgccaac
tgctacaccgccgtggagcagggcctggaagtggtgccggtgctcaacaagatcgacctg
cccaccgccgatatcgagcgggccaaggccgaaatcgaggcggtgatcggcatcgacgcc
gaggatgcggtggcggtcagtgccaagaccggcctcaatatcgatctggtgctcgaagcg
atcgtgcaccggattccgccgcccaagccgcgcgataccgacaagctgcaggcgttgatc
atcgactcgtggttcgacaactacttaggtgtggtgtcgctggtgcgcgtgatgcagggc
gagatcaagccgggcagcaagatccaggtgatgtccaccggtcgtacgcatctggtcgac
aaggtcggcgtgttcacacccaagcgcaaggaactggtggcactgggcgccggcgaagtg
ggctggatcaatgcctcgatcaaggacgtgcacggcgcgccggtcggcgacaccctcacc
ctggcggccgacccggcgccgcacgcattgcccggtttccaggaaatgcagccgcgcgtg
ttcgccggcctgtttccggtcgatgccgaggactatccggacctgcgcgaagcgctggac
aagctgcgtctgaacgatgccgcgttgcgcttcgagccggaaagctccgaggcgatgggc
ttcggcttccgttgcggcttcctgggcatgctgcacatggaaatcgtgcaggaacggctg
gagcgcgagtacaacctcaatctgatttcgaccgcgccgacggtggtctatgaggtgctc
aagaccgacggcaccatcatcccgatggacaatccgtccaagctgccgccgctcaaccac
gtggaagagatccgcgagccgatcatccgcgccaatatcctcacgccgcccgattacgtc
ggcaacatcatcacgctgtgcgaagaaaagcgcggcagccagatcggcatcaactacctc
ggtagccaggtgcagatcagctacgagctgccgatggccgaagtggtgctggacttcttc
gacaagctcaagtcggtctcgcgtggttacgcctctctggattatcacttcctgcgtttc
gatgccggcccgttcgtgcgcgtggacacgctgatcaacggcgacaaggtcgatgcgctg
agcatcatcgtgcaccgcagctacgccgatcggcgcggccgcgagctgtgcgaaaagatg
aaggagctgatcccgcggcagatgttcgacgtggcaattcaagccgccgtcggctcgcag
atcatctcgcgttctacggtcaaggcgatgcgcaagaacgtgttggccaaatgctatggt
ggcgacgtttcgcgcaagaaaaagctgctggaaaagcagaaagaaggcaagaagcgcatg
aagcaggtcggccgcgtggagattccgcaggaggccttcctggccgttctgcagatggat
aagtag

DBGET integrated database retrieval system