KEGG   Xanthomonas campestris pv. campestris 8004: XC_2973Help
Entry
XC_2973           CDS       T00247                                 

Definition
(GenBank) regulatory protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RseA_N zf-HC2
Motif
Other DBs
NCBI-ProteinID: AAY50021
UniProt: A0A0H2X9P9
Position
complement(3558304..3559164)
Genome map
AA seq 286 aa AA seqDB search
MTNNPDMSTTDKFERHYRQQLSALVDGELSAEESRFLLRRLAHDEELAGCQERWQLCGDV
LRGAASAPAPLDFTAKVRAAVAEEPAPAAAPAARPAARWRWGGGAALAASVAAIALFVSR
ERLPEVAAPAPAEQVFATTAQLPASTPAPQAPKAPDAPDDVVALAAAVPAAALASARRGA
ATRNQQVARSVAARNQQAPARMVASAAAPAATPAVASPAAANPFTHPEATLQARPWPRAA
LAGSGESPLNASFSQSRQAPAFYPFEPAPQAAAAAGRAQPAPPPQD
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataaccctgacatgtccaccaccgacaagttcgaacgtcattatcgccagcag
ctgtccgcgctggtggatggcgagctgagtgccgaggagtcgcgctttttgctgcggcgc
ctggcccatgacgaagagttggccggctgccaggagcgctggcagctctgcggcgatgtg
ctgcgcggcgcggcaagtgccccggcgccgctggatttcaccgccaaggtgcgcgctgcc
gtggccgaagaaccggcacctgccgcggcgcccgctgcacgccctgcggcgcgctggcgt
tgggggggcggtgctgcgttggcggcatcggtcgccgcgatcgccttgttcgtgtcccgc
gaacggctgcctgaggtggccgcgcccgcgcccgccgagcaggtgttcgccaccaccgca
cagctacccgcatccactcccgccccacaggcgccgaaggccccggatgcgccggacgac
gtggttgccctggcggcggccgtgcccgcggcggcgctggcctcggcccggcgtggcgcg
gcgacccgcaatcagcaggtcgctcgcagcgtggcggcgcgcaaccagcaggcaccggcc
cggatggtggcctcggctgcggccccggctgcaacgcccgcggtcgcctcgccggcggca
gcaaacccgttcacgcatcctgaagccacgctgcaggcccgcccgtggccacgcgccgca
ctggcggggtcgggcgaaagcccgctcaacgccagcttcagtcaaagccggcaggcgcca
gcgttctatccgttcgagcccgccccgcaggcggccgctgcggcaggccgagcacagcca
gctccgccgccgcaggactga

DBGET integrated database retrieval system