KEGG   Xanthomonas campestris pv. campestris 8004: XC_2974Help
Entry
XC_2974           CDS       T00247                                 

Definition
(GenBank) RNA polymerase sigma-H factor
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:xcb03021]
    XC_2974
Transcription machinery [BR:xcb03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     XC_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 Sigma70_ECF HTH_23 HTH_16 Phage_antitermQ HTH_40 GerE
Motif
Other DBs
NCBI-ProteinID: AAY50022
UniProt: A0A0H2XB69
Position
complement(3559161..3559781)
Genome map
AA seq 206 aa AA seqDB search
MAEVDTPQELDLELVRRVQRGESAAFDVLVRKYQHRIVALIGRYIADWSECQDVAQDTFV
RAYRAINSFRGDAQFYTWLHRIAVNTAKNHLVAHNRRPPTDDIDVSDAEQFDGATRLRDT
DTPERELMRQELEQTVMRAVQALPEELRSAITLREVEGLSYEEIARKMDCPIGTVRSRIF
RAREAIDIELRPLLETESATRERHRV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagtcgatacacctcaggagctggatctggaactggtccggcgtgtgcagcgc
ggcgagagcgcggcgttcgatgtgttggtgcgcaagtaccagcaccggatcgtcgccctg
atcgggcgctacatcgccgactggagcgaatgccaggacgtggcccaggatacgtttgtg
cgcgcttaccgcgcgatcaacagttttcgtggcgacgcccagttctatacgtggctgcac
cgcattgccgtgaacactgccaagaaccacctggttgcgcacaatcgccgcccgcccacc
gatgacatcgacgtcagcgacgccgaacaattcgatggtgcgacccgcttgcgcgacacc
gacaccccggagcgcgaattgatgcgacaggagctggaacaaacggtgatgcgtgcggtc
caagccttgccggaagaactccggtcggccatcaccctgcgcgaggtggaagggctgagt
tacgaggagatcgcgcgaaagatggattgcccgatcggaacggtgcgctcgcgcatcttc
cgggcgcgcgaggccatcgacatcgagctacggcctctgctggagaccgaaagcgctacc
cgtgagcgacaccgtgtatga

DBGET integrated database retrieval system