KEGG   Xanthomonas campestris pv. campestris 8004: XC_2976Help
Entry
XC_2976           CDS       T00247                                 

Definition
(GenBank) cobalt-zinc-cadmium resistance protein
  KO
K16264  cobalt-zinc-cadmium efflux system protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xcb02000]
    XC_2976
Transporters [BR:xcb02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   XC_2976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux
Motif
Other DBs
NCBI-ProteinID: AAY50024
UniProt: A0A0H2XB72
Position
complement(3562273..3563238)
Genome map
AA seq 321 aa AA seqDB search
MGHDHSHAPSEIRHETPLWWALALTATFLVAEVIGAFVSNSLALLSDAAHMATDTLGLMI
ALVAVRLSRRPADARRTYGYVRLEALGALVNGALLFGVGAYILWEAAQRFRAPQDISSNG
MLLIAGLGLVINLIAMKLLHAGSGESLNVKGAYLEVWSDMLGSVAVIIGALLIRWTGWQW
IDPVLAVLIGLWVLPRTWVLLREAINVLLEGVPKGVDLAQVRQALTGHPDVDDVHDLHVW
ALASSTPALTAHVVVGETIDRDRLRQTLGELLHDRFDIAHVTLQVESGDCGADPCGTPST
PAAAGEAHSHAHGQGAHHHSH
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggacacgatcacagccacgcacccagcgaaatccgccacgaaacaccgctctggtgg
gcgctggctctcaccgccaccttcctcgttgccgaagtcatcggcgcgttcgtgtccaac
agtctggcgctgttgtcggatgcggcgcacatggcgaccgacaccttgggattgatgatc
gcactggtcgcggtccggctcagccggcgcccggcagacgcgcgtcgtacctacggttac
gtgcgccttgaagcgctgggtgcattggtcaatggcgcgctgctgttcggcgtgggcgcc
tatatcctctgggaagccgcgcaacggtttcgcgcaccgcaggatatttcctccaacggc
atgctgctgatcgccgggctgggcctggtgatcaacctgatcgcgatgaagctgctgcac
gccggcagtggcgaaagcctcaacgtcaagggcgcgtatctggaagtctggagcgacatg
ctcggctcggtcgcggtgatcatcggcgccttgctgatccggtggactggctggcagtgg
atcgacccagtgctggcggtgctgatcggcctatgggtattgccgcgcacctgggtgttg
ctgcgcgaagccatcaatgtgctgctggaaggcgtgccgaaaggcgtggatctcgcccag
gtacgccaagccctgaccgggcacccggacgtggacgacgtgcatgatctgcacgtctgg
gccctggcctccagcaccccggccttgacggcccacgtggtggttggcgaaacgatcgac
cgcgaccgcctgcgtcaaacgctgggcgaactgctgcacgaccgcttcgacatcgcgcac
gtcaccttgcaggtggagagcggcgattgcggagccgatccgtgcggcacgccttccacg
ccggctgctgcgggcgaggcgcatagtcatgcgcatggccagggcgcgcatcatcattcc
cactag

DBGET integrated database retrieval system