KEGG   Xanthomonas campestris pv. campestris 8004: XC_2977Help
Entry
XC_2977           CDS       T00247                                 

Definition
(GenBank) 3-hydroxyisobutirate dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00280  Valine, leucine and isoleucine degradation
xcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XC_2977
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     XC_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C 3HCDH_N IlvN Sacchrp_dh_NADP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AAY50025
UniProt: A0A0H2X9B7
Position
complement(3563789..3564676)
Genome map
AA seq 295 aa AA seqDB search
MSKIAFIGLGNMGGPMVANLIKAGHELRVFDLVHSALDTAHAAGAQVASSASDTLHGAEV
VISMLPASKHVEGLYLGDAGILAHIPAGALVIDCSTIAPAMARTVATAAHARGLDMLDAP
VSGGTAGAAAGTLTFIVGGAAQALERARPVLQAMGKNLFHVGDNGAGQVAKLCNNMALGV
IMAATGEAIALGVAQGLDPAVLSQMMAVSTGRSWATEVCNPWPGVLENAPASRGYSGGFG
NDLMLKDLGLVAEAAVQAGASIPLGELARNLYAMNSRAGNGALDFSSVVKLVAKV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcgcttttatcggcctgggcaacatgggcgggccgatggtcgccaacctg
atcaaggccgggcacgagctgcgtgtgttcgacctggtgcacagtgcattggataccgca
catgccgccggcgcgcaggtggccagttccgcaagcgacaccctgcacggcgcggaggtc
gtcatctccatgttgcctgccagcaagcacgtggaagggctgtatctgggcgatgccggc
atccttgcgcacattcccgccggcgcgttggtgatcgattgcagcaccattgcgccggca
atggcacgcacggtggccactgctgcgcatgcgcgcggcctggacatgctggatgcgccg
gtgtccggcggcactgctggcgcggcagccggcacactcaccttcatcgtgggcggcgct
gcacaggcgctggaacgcgcgcgtccggtgctgcaggcgatgggcaagaacctcttccac
gtcggcgacaacggcgccgggcaggtggccaagctgtgcaacaacatggcgttgggtgtg
atcatggccgccaccggcgaagccatcgcgctgggcgtggcgcaggggctcgacccggcg
gtgttgtcgcagatgatggcggtcagcaccgggcgcagctgggccaccgaggtctgcaac
ccgtggcccggtgtgctggagaacgcacccgcctcgcgcggctacagcggcggttttggc
aatgacctcatgctcaaggacctgggcctggtcgccgaggccgcggtgcaggcgggcgca
tcgattccgctgggtgagctggcgcgcaacctctacgccatgaacagccgggctggcaat
ggcgcgctggatttctccagcgtggtcaagctggtggccaaggtgtga

DBGET integrated database retrieval system