KEGG   Xanthomonas campestris pv. campestris 8004: XC_2978Help
Entry
XC_2978           CDS       T00247                                 

Definition
(GenBank) enoyl-CoA hydratase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AAY50026
UniProt: A0A0H2X9Q3
Position
complement(3564693..3565865)
Genome map
AA seq 390 aa AA seqDB search
MVEINASDHSPVLFEQRACADGHSIGIATLNAPKTLNGLSLEMTRLLDAQLRAWADDAQI
ACVVLRGAGEKAFCAGGDLHGLYQSMRAHAEAVPEIARRAAQPQANAHAAAFFEEEYRLD
HRIHTFPKPVLCWGHGIVMGGGIGLMSGASHRVVTERSRLAMPEISVGLFPDVGGSWLLR
RVPHGSGLFLALSGAPLNASDAIYAGLADVRLEHVQYDAVLDALSAHAWTGDAAHDRAQL
GAFLQGLAQPVEPGPLQLHAALIASIVSAGTLQQVADALLALQSEDAWLQAARATFAAGA
PGSARLAWELQRHPGTTTLADAFRTEYMVALHAAAHGDFAEGIRALLIDKDRQPAWQPPT
LEQADAAWAATFFTAPWPAGQHRLADLGAR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaataaacgcctccgatcattcaccggtgctgttcgagcaacgtgcctgcgcc
gatggtcactccatcggcatcgccaccttgaacgcgcccaagaccctcaacggtctgtcg
ttggagatgacgcgactgctggacgcgcaactacgtgcctgggccgatgatgcgcagatt
gcctgcgtggtcttgcgtggcgccggtgaaaaggcgttctgcgccggtggcgatctgcat
gggctgtaccagagcatgcgtgcgcatgcggaggcggtgcccgagatcgcgcggcgcgct
gcgcagccacaggccaacgcgcatgccgctgcgtttttcgaagaggaataccgcctcgac
catcgcatccacacctttcccaagccggtgttgtgctgggggcacggcattgtgatgggc
ggcggcatcggcttgatgtcgggtgccagccatcgcgtggtcaccgagcgctcgcggctg
gcaatgccggagatcagcgtgggattgtttccggacgtgggcggcagctggttgctgcgc
cgcgtgccccacggcagcggtctgtttctcgcgctcagcggcgcaccgctcaacgccagc
gacgccatctacgccggactggccgacgtgcgcctggaacatgtgcaatatgatgcggtg
ctggatgcgctgagcgcgcatgcctggaccggtgatgccgctcacgatcgcgcgcagctg
ggcgctttcctgcagggcctggcgcagccagtggaacccggccccttgcaactgcacgct
gcgctgatcgcgagcatcgtctcggccggcacgctgcagcaggttgccgacgcgctactg
gcactgcaaagcgaagacgcctggctgcaggccgcgcgcgccacctttgccgctggcgcg
ccgggttctgcacggctggcgtgggagctgcagcgccatcccggcaccaccacgctggcg
gacgcgtttcgcaccgaatacatggtggcgttgcacgcagccgcgcatggcgatttcgcc
gaaggcatccgtgcgttgttgatcgacaaggatcgccagcccgcatggcaaccgccaacg
ctggaacaggccgatgcggcctgggcagccaccttcttcactgcgccgtggccggcggga
cagcaccgactggccgaccttggcgcgcgttaa

DBGET integrated database retrieval system