KEGG   Xanthomonas campestris pv. campestris 8004: XC_2982Help
Entry
XC_2982           CDS       T00247                                 

Definition
(GenBank) transcriptional regulator
  KO
K21686  XRE family transcriptional regulator, fatty acid utilization regulator
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xcb03000]
    XC_2982
Transcription factors [BR:xcb03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    XC_2982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2083 Peptidase_M78 HTH_31 HTH_3 HTH_19 HTH_25 HTH_37 HTH_24 MarR_2 Sigma70_r4 HTH_Crp_2 HTH_23 HTH_38 HTH_26 MarR Sigma70_r4_2 Death NADH_B2
Motif
Other DBs
NCBI-ProteinID: AAY50030
UniProt: A0A0H2X9C1
Position
3569487..3570869
Genome map
AA seq 460 aa AA seqDB search
MPQSSALLRHQLGLRLQRLRQRHGLTQAELARRLGLSPSYLNQIERNQRPLTLAIQQRLK
TALGDLDGLLSADDPAALVEPLDEALRALGHGLSAAELRMLTGNLPQVAQALLDLQRAHT
HLQERTAALEVQVGAEHAALPSLSPGEQVRDYFNRAHNYLPELDERAEALYTELGLTPEN
LRLRLRQRLADRHGLLVQEAPDLHSDKRSVDVQARVLWLPAHLRPGQQAFQMAAQLALLE
CGPLLDARIADAGFEDAERIALSRIGLSNYFAGALVMPYTPFLHSAQASRYDIEWLADRF
GVGFEAVCHRLSTLQRRGAAGLPIFFMRVDRAGNVSKRHSATDFHFSHVGGACPLWIVYE
AFNQPDRILTQIARMPDGRRYFWLARQVTSGPPGYGRPRKTFALAMGCDLRHADQLVYAR
GWDLGAVDDAVRIGPGCLTCERSDCVQRAFPALPRLPATR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtccagcgctctcctccgccatcagctcggcctgcgcctgcagcgcctgcgc
cagcggcacgggctgacccaggccgaactggcacgtcggctcggcctctccccgagctat
ctcaaccagatcgaacgcaaccagcgcccgctgacgctggcgatccagcaacgcctcaaa
accgcgctgggcgacctggacggcctgctgagcgcggacgacccggcggcactggtcgag
ccgctggatgaggcgttacgtgcgctcgggcatggcctgtcggcggcggaactgcgcatg
ctcaccggcaacctgccgcaggtggcacaggcgctgctggacctgcagcgcgcgcatacg
catctgcaagagcgcactgccgcgctggaagtgcaggtgggcgccgaacacgccgcgttg
ccgtcgctgtcgccgggcgagcaggtgcgcgactacttcaaccgcgcgcacaactacctg
cccgagctcgacgaacgcgccgaggcgctctacaccgaacttgggctgaccccggaaaac
ctgcgtctgcgtctgcgccagcgcctggccgaccgccacgggctgcttgtgcaggaagca
cctgacctgcacagcgacaaacgcagcgtggatgtgcaggcgcgcgtgctgtggctgccc
gcccatctgcgccctggccagcaagcgttccagatggcggcgcaattggccttgctggaa
tgtgggccgctactcgatgcgcgcatcgccgatgccgggtttgaggatgccgaacgcatt
gcgttgtcgcggatcggcttgtcgaactatttcgccggcgcgctggtgatgccgtacacg
ccgttcctgcacagcgcgcaggcatcgcgctacgacatcgagtggctggccgaccgcttc
ggcgtcggcttcgaggcggtgtgtcatcgcctgagcaccttgcagcggcgcggtgcggca
ggcctgccgatctttttcatgcgcgtggaccgtgccggcaatgtgtccaaacgccactcc
gccaccgacttccatttttcgcacgtcggcggcgcctgcccgttgtggatcgtctacgaa
gccttcaaccagcccgaccgcatcctcacccagatcgcacgtatgcccgatggccgtcgc
tatttctggctggcccggcaggtgaccagcgggccgcccggctatgggcggccacgcaag
accttcgcgctggcgatgggctgcgacctgcgccatgccgatcaactggtctacgcacgt
ggctgggatctgggcgcagtggacgatgcagtaaggatcggcccgggctgcctgacctgc
gaacgcagcgactgtgtgcagcgcgcattcccggcgctgccacggcttccggccacgcgt
tag

DBGET integrated database retrieval system