KEGG   Xanthomonas campestris pv. campestris 8004: XC_2984Help
Entry
XC_2984           CDS       T00247                                 

Definition
(GenBank) arabinogalactan endo-1,4-beta-galactosidase
  KO
K01224  arabinogalactan endo-1,4-beta-galactosidase [EC:3.2.1.89]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    XC_2984
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.89  arabinogalactan endo-beta-1,4-galactanase
     XC_2984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_53 Cellulase LigB DUF4434
Motif
Other DBs
NCBI-ProteinID: AAY50032
UniProt: A0A0H2XB77
Position
3574081..3575289
Genome map
AA seq 402 aa AA seqDB search
MRSTHRLWAPALLALALSTAAYAAPAPKTLYLGADLSYVNEMEECGVQYRENGVVKDPFE
LFHTHGANLVRVRLWNDARWTKYSDLSDVKKTIRRARAQGMQVLLDLHYSDDWADGEKQL
IPKAWASITDTDELARTLYGFTYDTLSALDRAGLMPELVQVGNESNSDLMDSIPWDKKRP
IDWQRNAKLFNAGIKAVRDISARSTIKPRVMLHIAQPENVEPWFAAAAKAGVTDFDLIGI
SYYRKWSSQSMAELGKTIKRLRGRFDADVVVVETAYPWTLASGDTSHNLLGEDSLIAGYP
ATPQGQARYMVDLTQLVIDTGGAGVVYWEPAWTSSSCKTRWGTGSSWENASFFDFQHNNE
VLPAIDFMRHPYTGVPASHRSEAGKPAIDTQGDAADNKRAQP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccactcaccgcctctgggcgccggcgctgctcgcgctggcactgtccaccgcc
gcttacgccgcacccgccccgaaaacgctgtatctgggcgcggacctgtcctacgtcaac
gagatggaggaatgcggcgtgcagtaccgcgagaacggggtggtgaaagacccgttcgaa
ctcttccatacacatggcgccaacctggtgcgtgtgcggctgtggaatgacgcacgctgg
accaaatacagcgacctgtcggacgtcaagaagaccatccgccgcgcgcgcgcgcagggc
atgcaggtactgctggacctgcactactccgatgattgggccgatggcgaaaaacagctg
attcccaaggcctgggccagcatcaccgacaccgacgagctggcgcgcacgctctacggg
tttacctacgacacgctgagcgcactcgatcgcgccgggctgatgcccgagctggtgcag
gtgggcaacgaaagcaattccgacctgatggacagcattccctgggacaagaagcgcccg
atcgactggcaacgcaacgccaagctgttcaatgcgggcatcaaggcggtgcgcgacatc
agcgcacgttcgaccatcaaaccgcgggtgatgctgcatatcgcccagccggaaaatgta
gagccgtggttcgccgccgccgccaaggccggcgtgaccgacttcgatttgatcggcatc
agctactaccgcaagtggtccagccagtcgatggccgagctgggcaagaccatcaagcgc
ctgcgcggccgctttgatgccgacgtggtggtggtggaaaccgcctacccgtggacgctg
gcatccggcgacacctcgcacaacctgctcggcgaagactcgctgattgccggttacccc
gccacgccgcaaggtcaggcgcgctacatggtggatctcacccaactggtgatcgatacc
ggcggcgccggcgtggtgtattgggagccggcatggaccagcagcagctgcaaaacacgc
tggggcaccggctcgtcgtgggagaacgccagcttcttcgatttccagcacaacaacgaa
gtgctgccggcgatcgacttcatgcgccatccgtataccggcgtgcctgcatcgcatcgc
tccgaagcaggcaagcctgctatcgacacgcaaggcgacgctgccgacaacaagagggcg
cagccatga

DBGET integrated database retrieval system