KEGG   Xanthomonas campestris pv. campestris 8004: XC_2990Help
Entry
XC_2990           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XC_2990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcb04147]
    XC_2990
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     XC_2990
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XC_2990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha_L_fucos F5_F8_type_C GHL6
Motif
Other DBs
NCBI-ProteinID: AAY50038
UniProt: A0A0H2X9N1
Position
complement(3583394..3585322)
Genome map
AA seq 642 aa AA seqDB search
MIDRRTFLATGVVAATASFSASAARIVQTPRANGPAPWGALPSKRQLRWHRWEQYAFVHF
AMNTFTDKEWGYGDEDPRKFDPSDFLPDQIVAAAKAGNLKGLIFTAKHHDGFCLWPTRLT
EHCIRNSPYKSGKGDIVGEMAAACRRAGLAFGIYLSPWDRNHAEYGRPGYLDYFRKQIVE
LCTGYGDLFEFWFDGANGGDGYYGGARESRKIDAPAYYNWPRMIELVHQHQPMACTFDPL
GADIRWGGNEDGIAGDPSWPTMPNAPYTQENGNSGVRGAALWWPAETNTSIRPGWFYHAD
EDGKVRSPENLVRYFDTSVARGTNMNLNLPPDRRGRIPDHDVAVLKSFGDAIRASFAIDL
ARGAKASASASHGPGFEPARVLDRQPDSYWSAPDDVTTPTLTLELSALHSFDLIRLREYL
PLGVRVTRFAVEAEVDGQWRRLAEAQCIGAQRIVRLDRPVAARRVRLVVLEAPVCPAISE
FALFRAVAPVPVARPTANAPDVLSTAGWRVVEASAPGAEKLLDDDASTVWSTPAPTPGHP
VQATIDLGALHQVAGFSLTPSRTVMAGAAPPKGYRAETSEDGQHWQPAGSGELSNIAYAL
STQRLNFPEVRQIRYLRLSFAETAVPADRLAIAGIGAFSRLR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgtcgtacctttcttgccacgggggtggttgccgctaccgccagcttcagt
gcatcggcggcgcggatcgtgcagacgccgcgtgccaacgggccggcgccgtggggtgcg
ctgcccagcaagcgacaactgcgctggcatcggtgggagcaatacgccttcgtgcatttt
gcgatgaacaccttcaccgacaaggaatggggctacggcgacgaggatccgcgcaaattc
gatcccagcgattttttacccgatcaaatcgttgctgctgccaaggctggcaatctgaaa
gggcttattttcacggccaagcaccacgatgggttctgtctttggccgacgcgcttgacc
gagcattgcatccggaactcgccctacaagagcggcaagggtgacatcgtcggcgaaatg
gcagcggcgtgtcgacgcgccggcctggcgttcggcatctacctctcgccctgggatcgc
aatcacgccgaatatggtcgccccggctatctcgactatttccgcaagcagatcgtcgag
ctctgcacaggctatggcgacctgttcgagttctggtttgacggcgccaatggcggcgac
ggctactacggtggagcgcgcgaatcgcgcaagatcgatgcgcccgcgtactacaactgg
ccacggatgatcgagctggtgcatcaacatcagccgatggcctgtaccttcgacccgctc
ggcgccgatatccgctggggcggcaacgaggatggtattgccggggatccatcctggccg
accatgcccaatgcgccgtatacccaggaaaacggtaattccggcgtgcgcggcgcggcg
ctgtggtggccggccgaaaccaacacctcgatccgcccgggctggttctaccatgccgat
gaagacggcaaggtgcgtagcccggagaatctggtgcgctatttcgacacctccgtcgcg
cgcggcaccaacatgaacctcaatcttccgcccgaccgacgcggccgcatccccgaccac
gacgtggcggtgctgaagagtttcggcgacgcgatccgcgccagcttcgccatcgatctg
gccaggggtgccaaggccagtgccagcgcatcgcatggccctgggttcgagccggcgcgc
gtcctcgaccgccagccggacagctactggtccgctccggacgatgtcaccacgccgacg
ctgacgctggagctgtcggcgctgcacagtttcgacctgatccggctgcgcgaatatctg
ccgctgggcgtgcgcgtcacccgctttgcggtcgaagccgaggtcgatgggcaatggcgt
cggctggccgaagcgcagtgcatcggtgcccagcgcatcgtgcggctggatcgcccggtc
gccgcgcgccgggtgcgcctggtggtgcttgaggcgccggtgtgcccggcaatcagcgaa
ttcgcgctgttccgcgccgttgcgccagtgccggtcgcgcggcctacagcgaacgcacca
gatgtgctgtccaccgccggctggcgagtggtcgaggcgagcgcgccaggggcggaaaaa
ttgctcgacgacgatgccagcacggtctggagtacgcccgcgccgacgccgggccatccc
gtgcaggccaccatcgacctcggtgcgctgcatcaggttgccggcttcagcctcacgccc
tcgcgcacggtgatggccggtgcggcaccgccgaagggctatcgcgctgaaaccagcgaa
gatgggcagcactggcagccggccggtagtggtgagctgtccaatatcgcctatgcgctc
tcgacccagcgcctgaattttcccgaggtccgccagattcgctacctgcggctgtcgttc
gcggaaacggcggtgcccgccgaccggttggcgatcgcgggtatcggcgcgttctcgcgc
ttgcgatga

DBGET integrated database retrieval system